Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  PVHL:ELOB:ELOC COMPLEX, IN COMPLEX WITH CAPPED HYDROXYPROLINE
 
Authors :  I. Van Molle, A. Thomann, D. L. Buckley, E. C. So, S. Lang, C. M. Crews, A.
Date :  04 Jun 12  (Deposition) - 14 Nov 12  (Release) - 14 Nov 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Biol. Unit 3:  G,H,I  (1x)
Biol. Unit 4:  J,K,L  (1x)
Keywords :  Transcription, E3 Ubiquitin Ligase, Tumor Supressor (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Van Molle, A. Thomann, D. L. Buckley, E. C. So, S. Lang, C. M. Crews, A. Ciulli
Dissecting Fragment-Based Lead Discovery At The Von Hippel- Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein- Protein Interface.
Chem. Biol. V. 19 1300 2012
PubMed-ID: 23102223  |  Reference-DOI: 10.1016/J.CHEMBIOL.2012.08.015

(-) Compounds

Molecule 1 - TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
    ChainsA, D, G, J
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPDUET1
    Expression System Vector TypePLASMID
    FragmentRESIDUES 1-104
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymELONGIN 18 KDA SUBUNIT, ELONGIN-B, ELOB, RNA POLYMERASE II TRANSCRIPTION FACTOR SIII SUBUNIT B, SIII P18
 
Molecule 2 - TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 1
    ChainsB, E, H, K
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPCDF_DUET1
    Expression System Vector TypePLASMID
    FragmentRESIDUES 17-112
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    Other DetailsEXTRA M AT N-TERMINUS AS RESULT OF CLONING
    SynonymELONGIN 15 KDA SUBUNIT, ELONGIN-C, ELOC, RNA POLYMERASE II TRANSCRIPTION FACTOR SIII SUBUNIT C, SIII P15
 
Molecule 3 - VON HIPPEL-LINDAU DISEASE TUMOR SUPPRESSOR
    ChainsC, F, I, L
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPET28
    Expression System Vector TypePLASMID
    FragmentRESIDUES 54-213
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROTEIN G7, PVHL

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit ABCDEFGHIJKL
Biological Unit 1 (1x)ABC         
Biological Unit 2 (1x)   DEF      
Biological Unit 3 (1x)      GHI   
Biological Unit 4 (1x)         JKL

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 24)

Asymmetric Unit (5, 24)
No.NameCountTypeFull Name
1ACT6Ligand/IonACETATE ION
2ACY1Ligand/IonACETIC ACID
3CAS12Mod. Amino AcidS-(DIMETHYLARSENIC)CYSTEINE
4GOL1Ligand/IonGLYCEROL
5V6F4Ligand/Ion(4R)-1-ACETYL-4-HYDROXY-N-METHYL-L-PROLINAMIDE
Biological Unit 1 (3, 7)
No.NameCountTypeFull Name
1ACT3Ligand/IonACETATE ION
2ACY-1Ligand/IonACETIC ACID
3CAS3Mod. Amino AcidS-(DIMETHYLARSENIC)CYSTEINE
4GOL-1Ligand/IonGLYCEROL
5V6F1Ligand/Ion(4R)-1-ACETYL-4-HYDROXY-N-METHYL-L-PROLINAMIDE
Biological Unit 2 (4, 6)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2ACY1Ligand/IonACETIC ACID
3CAS3Mod. Amino AcidS-(DIMETHYLARSENIC)CYSTEINE
4GOL-1Ligand/IonGLYCEROL
5V6F1Ligand/Ion(4R)-1-ACETYL-4-HYDROXY-N-METHYL-L-PROLINAMIDE
Biological Unit 3 (3, 5)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2ACY-1Ligand/IonACETIC ACID
3CAS3Mod. Amino AcidS-(DIMETHYLARSENIC)CYSTEINE
4GOL-1Ligand/IonGLYCEROL
5V6F1Ligand/Ion(4R)-1-ACETYL-4-HYDROXY-N-METHYL-L-PROLINAMIDE
Biological Unit 4 (4, 6)
No.NameCountTypeFull Name
1ACT1Ligand/IonACETATE ION
2ACY-1Ligand/IonACETIC ACID
3CAS3Mod. Amino AcidS-(DIMETHYLARSENIC)CYSTEINE
4GOL1Ligand/IonGLYCEROL
5V6F1Ligand/Ion(4R)-1-ACETYL-4-HYDROXY-N-METHYL-L-PROLINAMIDE

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWARETRP L:88 , TYR L:98 , HIS L:110 , SER L:111 , TYR L:112 , HIS L:115 , TRP L:117BINDING SITE FOR RESIDUE V6F L1206
02AC2SOFTWARETRP C:88 , TYR C:98 , HIS C:110 , SER C:111 , TYR C:112 , HIS C:115 , TRP C:117BINDING SITE FOR RESIDUE V6F C1201
03AC3SOFTWARETRP F:88 , TYR F:98 , HIS F:110 , SER F:111 , TYR F:112 , HIS F:115 , TRP F:117BINDING SITE FOR RESIDUE V6F F1205
04AC4SOFTWARETRP I:88 , TYR I:98 , HIS I:110 , SER I:111 , TYR I:112 , HIS I:115 , TRP I:117BINDING SITE FOR RESIDUE V6F I1206
05AC5SOFTWAREHIS A:10 , LYS A:11 , THR A:12BINDING SITE FOR RESIDUE ACT A1104
06AC6SOFTWARETYR B:18 , VAL B:19 , LYS B:20 , ILE B:30BINDING SITE FOR RESIDUE ACT B1113
07AC7SOFTWAREARG L:161BINDING SITE FOR RESIDUE ACT L1207
08AC8SOFTWAREARG C:82 , ARG C:161BINDING SITE FOR RESIDUE ACT C1202
09AC9SOFTWAREPHE J:4 , LEU J:5 , PHE J:15 , THR J:16 , PRO J:69 , PRO J:72 , THR K:78BINDING SITE FOR RESIDUE GOL J1104
10BC1SOFTWAREARG F:167 , LYS F:171BINDING SITE FOR RESIDUE ACY F1206
11BC2SOFTWAREARG F:161BINDING SITE FOR RESIDUE ACT F1207
12BC3SOFTWAREARG I:161BINDING SITE FOR RESIDUE ACT I1207

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4AWJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4AWJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (120, 478)

Asymmetric Unit (120, 478)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827C/F/I/LL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826C/F/I/LR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616C/F/I/LS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826C/F/I/LS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826C/F/I/LS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---C/F/I/LS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802C/F/I/LE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803C/F/I/LV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---C/F/I/LF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---C/F/I/LF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033C/F/I/LF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---C/F/I/LN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804C/F/I/LN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---C/F/I/LN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---C/F/I/LR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805C/F/I/LS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805C/F/I/LS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---C/F/I/LS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806C/F/I/LP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890C/F/I/LR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827C/F/I/LV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481C/F/I/LP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---C/F/I/LP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034C/F/I/LP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---C/F/I/LP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481C/F/I/LP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---C/F/I/LW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277C/F/I/LW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807C/F/I/LL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807C/F/I/LL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---C/F/I/LF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808C/F/I/LG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---C/F/I/LG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808C/F/I/LG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---C/F/I/LQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809C/F/I/LY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---C/F/I/LL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---C/F/I/LL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---C/F/I/LG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---C/F/I/LT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---C/F/I/LG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440C/F/I/LR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609C/F/I/LR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706C/F/I/LH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---C/F/I/LS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631C/F/I/LS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945C/F/I/LS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824C/F/I/LY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824C/F/I/LY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---C/F/I/LG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636C/F/I/LG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---C/F/I/LG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---C/F/I/LH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812C/F/I/LH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811C/F/I/LH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---C/F/I/LL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215C/F/I/LW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830C/F/I/LL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---C/F/I/LL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---C/F/I/LF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---C/F/I/LF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832C/F/I/LD121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---C/F/I/LA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831C/F/I/LD126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---C/F/I/LL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830C/F/I/LV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---C/F/I/LN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---C/F/I/LN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278C/F/I/LL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833C/F/I/LF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833C/F/I/LF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---C/F/I/LF136Y
073UniProtVAR_005738D143EVHL_HUMANDisease (VHLD)  ---F/I/LD143E
074UniProtVAR_008100Q145HVHL_HUMANDisease (VHLD)771727849F/I/LQ145H
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---C/F/I/LI147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077C/F/I/LA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---C/F/I/LP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---C/F/I/LV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659C/F/I/LV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441C/F/I/LY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---C/F/I/LY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---C/F/I/LY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660C/F/I/LT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346C/F/I/LL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---C/F/I/LL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---C/F/I/LK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818C/F/I/LR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---C/F/I/LR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035C/F/I/LR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444C/F/I/LC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---C/F/I/LC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622C/F/I/LC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---C/F/I/LC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297C/F/I/LL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---C/F/I/LQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170C/F/I/LQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---C/F/I/LV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825C/F/I/LV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820C/F/I/LR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821C/F/I/LR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820C/F/I/LR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---C/F/I/LV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---C/F/I/LV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---C/F/I/LV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---C/F/I/LY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---C/F/I/LR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---C/F/I/LL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822C/F/I/LL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747C/F/I/LI180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---C/F/I/LL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---C/F/I/LL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984C/F/I/LE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---C/F/I/LL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---C/F/I/LL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824C/F/I/LL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301C/F/I/LH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300C/F/I/LP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---C/F/I/LL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---C/F/I/LL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298C/F/I/LR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (118, 118)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827CL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826CR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616CS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826CS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826CS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---CS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802CE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803CV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---CF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---CF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033CF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---CN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804CN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---CN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---CR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805CS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805CS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---CS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806CP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890CR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827CV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481CP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---CP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034CP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---CP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481CP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---CW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277CW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807CL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807CL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---CF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808CG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---CG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808CG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---CQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809CY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---CL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---CL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---CG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---CT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---CG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440CR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609CR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706CH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---CS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631CS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945CS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824CY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824CY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---CG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636CG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---CG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---CH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812CH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811CH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---CL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215CW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830CL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---CL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---CF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---CF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832CD121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---CA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831CD126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---CL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830CV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---CN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---CN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278CL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833CF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833CF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---CF136Y
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---CI147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077CA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---CP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---CV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659CV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441CY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---CY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---CY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660CT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346CL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---CL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---CK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818CR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---CR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035CR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444CC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---CC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622CC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---CC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297CL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---CQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170CQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---CV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825CV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820CR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821CR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820CR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---CV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---CV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---CV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---CY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---CR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---CL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822CL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747CI180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---CL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---CL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984CE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---CL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---CL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824CL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301CH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300CP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---CL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---CL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298CR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (120, 120)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827FL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826FR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616FS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826FS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826FS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---FS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802FE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803FV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---FF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---FF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033FF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---FN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804FN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---FN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---FR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805FS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805FS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---FS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806FP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890FR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827FV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481FP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---FP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034FP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---FP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481FP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---FW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277FW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807FL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807FL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---FF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808FG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---FG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808FG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---FQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809FY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---FL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---FL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---FG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---FT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---FG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440FR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609FR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706FH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---FS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631FS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945FS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824FY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824FY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---FG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636FG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---FG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---FH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812FH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811FH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---FL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215FW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830FL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---FL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---FF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---FF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832FD121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---FA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831FD126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---FL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830FV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---FN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---FN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278FL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833FF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833FF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---FF136Y
073UniProtVAR_005738D143EVHL_HUMANDisease (VHLD)  ---FD143E
074UniProtVAR_008100Q145HVHL_HUMANDisease (VHLD)771727849FQ145H
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---FI147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077FA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---FP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---FV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659FV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441FY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---FY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---FY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660FT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346FL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---FL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---FK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818FR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---FR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035FR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444FC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---FC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622FC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---FC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297FL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---FQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170FQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---FV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825FV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820FR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821FR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820FR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---FV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---FV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---FV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---FY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---FR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---FL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822FL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747FI180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---FL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---FL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984FE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---FL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---FL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824FL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301FH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300FP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---FL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---FL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298FR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (120, 120)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827IL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826IR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616IS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826IS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826IS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---IS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802IE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803IV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---IF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---IF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033IF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---IN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804IN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---IN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---IR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805IS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805IS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---IS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806IP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890IR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827IV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481IP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---IP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034IP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---IP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481IP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---IW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277IW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807IL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807IL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---IF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808IG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---IG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808IG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---IQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809IY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---IL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---IL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---IG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---IT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---IG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440IR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609IR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706IH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---IS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631IS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945IS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824IY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824IY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---IG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636IG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---IG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---IH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812IH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811IH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---IL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215IW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830IL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---IL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---IF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---IF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832ID121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---IA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831ID126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---IL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830IV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---IN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---IN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278IL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833IF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833IF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---IF136Y
073UniProtVAR_005738D143EVHL_HUMANDisease (VHLD)  ---ID143E
074UniProtVAR_008100Q145HVHL_HUMANDisease (VHLD)771727849IQ145H
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---II147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077IA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---IP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---IV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659IV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441IY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---IY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---IY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660IT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346IL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---IL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---IK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818IR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---IR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035IR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444IC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---IC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622IC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---IC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297IL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---IQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170IQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---IV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825IV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820IR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821IR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820IR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---IV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---IV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---IV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---IY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---IR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---IL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822IL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747II180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---IL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---IL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984IE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---IL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---IL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824IL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301IH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300IP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---IL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---IL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298IR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (120, 120)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827LL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826LR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616LS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826LS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826LS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---LS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802LE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803LV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---LF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---LF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033LF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---LN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804LN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---LN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---LR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805LS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805LS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---LS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806LP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890LR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827LV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481LP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---LP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034LP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---LP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481LP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---LW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277LW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807LL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807LL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---LF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808LG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---LG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808LG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---LQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809LY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---LL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---LL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---LG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---LT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---LG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440LR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609LR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706LH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---LS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631LS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945LS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824LY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824LY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---LG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636LG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---LG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---LH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812LH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811LH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---LL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215LW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830LL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---LL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---LF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---LF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832LD121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---LA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831LD126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---LL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830LV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---LN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---LN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278LL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833LF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833LF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---LF136Y
073UniProtVAR_005738D143EVHL_HUMANDisease (VHLD)  ---LD143E
074UniProtVAR_008100Q145HVHL_HUMANDisease (VHLD)771727849LQ145H
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---LI147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077LA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---LP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---LV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659LV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441LY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---LY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---LY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660LT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346LL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---LL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---LK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818LR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---LR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035LR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444LC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---LC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622LC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---LC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297LL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---LQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170LQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---LV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825LV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820LR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821LR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820LR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---LV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---LV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---LV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---LY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---LR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---LL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822LL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747LI180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---LL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---LL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984LE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---LL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---LL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824LL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301LH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300LP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---LL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---LL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298LR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  4A:1-66
D:1-66
G:1-66
J:1-66
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  1A:1-66
-
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  1-
D:1-66
-
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  1-
-
G:1-66
-
Biological Unit 4 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  1-
-
-
J:1-66

(-) Exons   (5, 20)

Asymmetric Unit (5, 20)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002564741aENSE00001930974chr3:10182692-101838711180VHL_HUMAN1-1141144C:62-114
F:63-114
I:62-114
L:62-114
53
52
53
53
1.4ENST000002564744ENSE00001163994chr3:10188198-10188320123VHL_HUMAN114-155424C:114-155 (gaps)
F:114-155
I:114-155
L:114-155
42
42
42
42
1.6dENST000002564746dENSE00001814424chr3:10191471-101939042434VHL_HUMAN155-213594C:155-200
F:155-204
I:155-205
L:155-205
46
50
51
51

2.1gENST000002848111gENSE00002103151chr8:74884341-7488427765ELOC_HUMAN-00--
2.6ENST000002848116ENSE00001087342chr8:74872053-7487200054ELOC_HUMAN1-220--
2.7ENST000002848117ENSE00001016720chr8:74868289-74868146144ELOC_HUMAN2-50494B:17-47
E:17-47
H:17-48
K:16-46
31
31
32
31
2.10dENST0000028481110dENSE00001424822chr8:74859055-74858636420ELOC_HUMAN50-112634B:57-112
E:57-112
H:58-112
K:58-112
56
56
55
55

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:102
 aligned with ELOB_HUMAN | Q15370 from UniProtKB/Swiss-Prot  Length:118

    Alignment length:103
                                    10        20        30        40        50        60        70        80        90       100   
           ELOB_HUMAN     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVM 103
               SCOP domains d4awja_ A: Elongin B                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeeee...hhhhhhhhhhhhhh.hhh.eeeee..ee......................eeeeeee..-..................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBIQUITIN_2  PDB: A:1-66 UniProt: 1-66                            ------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 4awj A   1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEcGFTSQTARPQAPATVGLAFRA-DTFEALcIEPFSSPPELPDVM 103
                                    10        20        30        40        50        60        70        80| |     90       100   
                                                                                      60-CAS               81 |     |              
                                                                                                             83     |              
                                                                                                                   89-CAS          

Chain B from PDB  Type:PROTEIN  Length:87
 aligned with ELOC_HUMAN | Q15369 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:96
                                    26        36        46        56        66        76        86        96       106      
           ELOC_HUMAN    17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
               SCOP domains d4awjb_ B: Elongin C                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeeehhhhh.hhhhhhhhh---------..eee....hhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) ---------------------------------Exon 2.10d  PDB: B:57-112 UniProt: 50-112 [INCOMPLETE]          Transcript 2 (1)
           Transcript 2 (2) Exon 2.7  PDB: B:17-47            -------------------------------------------------------------- Transcript 2 (2)
                 4awj B  17 MYVKLISSDGHEFIVKREHALTSGTIKAMLS---------TNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
                                    26        36        46|        -|       66        76        86        96       106      
                                                         47        57                                                       

Chain C from PDB  Type:PROTEIN  Length:136
 aligned with VHL_HUMAN | P40337 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:139
                                    71        81        91       101       111       121       131       141       151       161       171       181       191         
            VHL_HUMAN    62 VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER 200
               SCOP domains d4awjc_ C: automated matches                                                                                                                SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeeeee....eeeeee.....eee........eeeeeee...eeeeee.......ee............---.eeeeee....hhhhhhhhhhhh..hhhhhh....hhhhhhhhhh..hhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) -PPA--W-K---G-I-HPISP-L-A-RH-L-C--P-H--G--APDG--YCH-CQVCPL-GI---Y-F-LK---FC----------T-T----LGCIPE-GFPH-DG--D----DW-P-V---P-K-P--DS-----Q-W SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---L----------L-S-N-----H-SP---D-------R-----P---NN-RR--RS-----------T----S------------------MD-V--PR-R-FQ--F-------Q-----R---Q---------R-- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---W----------S-T-R-----L------S-----------------R--SY--------------------Y-------------------N----QW----W--G-----------------V------------ SAPs(SNPs) (3)
             SAPs(SNPs) (4) ------------------------R---------------------------------------------------------------------------Y-------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ------------------------S------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (5)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: C:62-114 UniProt: 1-114 [INCOMPLETE] ----------------------------------------Exon 1.6d  PDB: C:155-200 UniProt: 155-213     Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.4  PDB: C:114-155 (gaps)           --------------------------------------------- Transcript 1 (2)
                 4awj C  62 VLRSVNSREPSQVIFcNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNV---PIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER 200
                                    71     |  81        91       101       111       121       131       141|   |  151       161       171       181       191         
                                          77-CAS                                                          142 146                                                      

Chain D from PDB  Type:PROTEIN  Length:99
 aligned with ELOB_HUMAN | Q15370 from UniProtKB/Swiss-Prot  Length:118

    Alignment length:101
                                    10        20        30        40        50        60        70        80        90       100 
           ELOB_HUMAN     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPD 101
               SCOP domains d4awjd_ D: Elongin B                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeeee...hhhhhhhhhhhhhh.hhh.eeeee..ee......................eeeeeee.--................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBIQUITIN_2  PDB: D:1-66 UniProt: 1-66                            ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 4awj D   1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEcGFTSQTARPQAPATVGLAFR--DTFEALcIEPFSSPPELPD 101
                                    10        20        30        40        50        60        70        80  |     90       100 
                                                                                      60-CAS              80 83     |            
                                                                                                                   89-CAS        

Chain E from PDB  Type:PROTEIN  Length:87
 aligned with ELOC_HUMAN | Q15369 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:96
                                    26        36        46        56        66        76        86        96       106      
           ELOC_HUMAN    17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
               SCOP domains d4awje_ E: Elongin C                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeeehhhhh.hhhhhhhhh---------..eee....hhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) ---------------------------------Exon 2.10d  PDB: E:57-112 UniProt: 50-112 [INCOMPLETE]          Transcript 2 (1)
           Transcript 2 (2) Exon 2.7  PDB: E:17-47            -------------------------------------------------------------- Transcript 2 (2)
                 4awj E  17 MYVKLISSDGHEFIVKREHALTSGTIKAMLS---------TNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
                                    26        36        46|        -|       66        76        86        96       106      
                                                         47        57                                                       

Chain F from PDB  Type:PROTEIN  Length:142
 aligned with VHL_HUMAN | P40337 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:142
                                    72        82        92       102       112       122       132       142       152       162       172       182       192       202  
            VHL_HUMAN    63 LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE 204
               SCOP domains d4awjf_ F: automated matches                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeeee....eeeeee.....eee........eeeeeee...eeeeee.......ee..........hhhhh.eeeeee....hhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhh..hhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) PPA--W-K---G-I-HPISP-L-A-RH-L-C--P-H--G--APDG--YCH-CQVCPL-GI---Y-F-LK---FC------E-H-T-T----LGCIPE-GFPH-DG--D----DW-P-V---P-K-P--DS-----Q-W---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --L----------L-S-N-----H-SP---D-------R-----P---NN-RR--RS-----------T----S------------------MD-V--PR-R-FQ--F-------Q-----R---Q---------R------ SAPs(SNPs) (2)
             SAPs(SNPs) (3) --W----------S-T-R-----L------S-----------------R--SY--------------------Y-------------------N----QW----W--G-----------------V---------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------------------R---------------------------------------------------------------------------Y------------------------------------------ SAPs(SNPs) (4)
             SAPs(SNPs) (5) -----------------------S---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: F:63-114 UniProt: 1-114 [INCOMPLETE]----------------------------------------Exon 1.6d  PDB: F:155-204 UniProt: 155-213         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.4  PDB: F:114-155 UniProt: 114-155 ------------------------------------------------- Transcript 1 (2)
                 4awj F  63 LRSVNSREPSQVIFcNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE 204
                                    72    |   82        92       102       112       122       132       142       152       162       172       182       192       202  
                                         77-CAS                                                                                                                           

Chain G from PDB  Type:PROTEIN  Length:103
 aligned with ELOB_HUMAN | Q15370 from UniProtKB/Swiss-Prot  Length:118

    Alignment length:103
                                    10        20        30        40        50        60        70        80        90       100   
           ELOB_HUMAN     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVM 103
               SCOP domains d4awjg_ G: Elongin B                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeeee...hhhhhhhhhhhhhh.hhh.eeeee..ee......hhhhh...........eeeeeeeee..ee.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBIQUITIN_2  PDB: G:1-66 UniProt: 1-66                            ------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 4awj G   1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEcGFTSQTARPQAPATVGLAFRADDTFEALcIEPFSSPPELPDVM 103
                                    10        20        30        40        50        60        70        80        90       100   
                                                                                      60-CAS                       89-CAS          

Chain H from PDB  Type:PROTEIN  Length:87
 aligned with ELOC_HUMAN | Q15369 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:96
                                    26        36        46        56        66        76        86        96       106      
           ELOC_HUMAN    17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
               SCOP domains d4awjh_ H: Elongin C                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeeehhhhh...hhhhhh..---------.eee....hhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) ---------------------------------Exon 2.10d  PDB: H:58-112 UniProt: 50-112 [INCOMPLETE]          Transcript 2 (1)
           Transcript 2 (2) Exon 2.7  PDB: H:17-48            -------------------------------------------------------------- Transcript 2 (2)
                 4awj H  17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSG---------NEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
                                    26        36        46 |       - |      66        76        86        96       106      
                                                          48        58                                                      

Chain I from PDB  Type:PROTEIN  Length:144
 aligned with VHL_HUMAN | P40337 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:144
                                    71        81        91       101       111       121       131       141       151       161       171       181       191       201    
            VHL_HUMAN    62 VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQER 205
               SCOP domains d4awji_ I: automated matches                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........eeeeeeeee....eeeeee.....eee........eeeeeee...eeeeee.....eeee................eeeeee....hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh..hhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -PPA--W-K---G-I-HPISP-L-A-RH-L-C--P-H--G--APDG--YCH-CQVCPL-GI---Y-F-LK---FC------E-H-T-T----LGCIPE-GFPH-DG--D----DW-P-V---P-K-P--DS-----Q-W----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---L----------L-S-N-----H-SP---D-------R-----P---NN-RR--RS-----------T----S------------------MD-V--PR-R-FQ--F-------Q-----R---Q---------R------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---W----------S-T-R-----L------S-----------------R--SY--------------------Y-------------------N----QW----W--G-----------------V----------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ------------------------R---------------------------------------------------------------------------Y------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ------------------------S----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: I:62-114 UniProt: 1-114 [INCOMPLETE] ----------------------------------------Exon 1.6d  PDB: I:155-205 UniProt: 155-213          Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.4  PDB: I:114-155 UniProt: 114-155 -------------------------------------------------- Transcript 1 (2)
                 4awj I  62 VLRSVNSREPSQVIFcNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQER 205
                                    71     |  81        91       101       111       121       131       141       151       161       171       181       191       201    
                                          77-CAS                                                                                                                            

Chain J from PDB  Type:PROTEIN  Length:103
 aligned with ELOB_HUMAN | Q15370 from UniProtKB/Swiss-Prot  Length:118

    Alignment length:103
                                    10        20        30        40        50        60        70        80        90       100   
           ELOB_HUMAN     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVM 103
               SCOP domains d4awjj_ J: Elongin B                                                                                    SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeeee...hhhhhhhhhhhhhh.hhh.eeeee..ee......................eeeeeeeee..ee.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBIQUITIN_2  PDB: J:1-66 UniProt: 1-66                            ------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 4awj J   1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEcGFTSQTARPQAPATVGLAFRADDTFEALcIEPFSSPPELPDVM 103
                                    10        20        30        40        50        60        70        80        90       100   
                                                                                      60-CAS                       89-CAS          

Chain K from PDB  Type:PROTEIN  Length:86
 aligned with ELOC_HUMAN | Q15369 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:97
                                    25        35        45        55        65        75        85        95       105       
           ELOC_HUMAN    16 AMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
               SCOP domains d4awjk_ K: Elongin C                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.....eeeeehhhhh.hhhhhhh.-----------.eee....hhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) ----------------------------------Exon 2.10d  PDB: K:58-112 UniProt: 50-112 [INCOMPLETE]          Transcript 2 (1)
           Transcript 2 (2) Exon 2.7  PDB: K:16-46 [INCOMPLETE]-------------------------------------------------------------- Transcript 2 (2)
                 4awj K  16 MMYVKLISSDGHEFIVKREHALTSGTIKAML-----------NEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
                                    25        35        45|        -  |     65        75        85        95       105       
                                                         46          58                                                      

Chain L from PDB  Type:PROTEIN  Length:144
 aligned with VHL_HUMAN | P40337 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:144
                                    71        81        91       101       111       121       131       141       151       161       171       181       191       201    
            VHL_HUMAN    62 VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQER 205
               SCOP domains d4awjl_ L: automated matches                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........eeeeeeeee....eeeeee.....eee........eeeeeee...eeeeee.......ee................eeeeee....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -PPA--W-K---G-I-HPISP-L-A-RH-L-C--P-H--G--APDG--YCH-CQVCPL-GI---Y-F-LK---FC------E-H-T-T----LGCIPE-GFPH-DG--D----DW-P-V---P-K-P--DS-----Q-W----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---L----------L-S-N-----H-SP---D-------R-----P---NN-RR--RS-----------T----S------------------MD-V--PR-R-FQ--F-------Q-----R---Q---------R------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---W----------S-T-R-----L------S-----------------R--SY--------------------Y-------------------N----QW----W--G-----------------V----------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ------------------------R---------------------------------------------------------------------------Y------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ------------------------S----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: L:62-114 UniProt: 1-114 [INCOMPLETE] ----------------------------------------Exon 1.6d  PDB: L:155-205 UniProt: 155-213          Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.4  PDB: L:114-155 UniProt: 114-155 -------------------------------------------------- Transcript 1 (2)
                 4awj L  62 VLRSVNSREPSQVIFcNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQER 205
                                    71     |  81        91       101       111       121       131       141       151       161       171       181       191       201    
                                          77-CAS                                                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 12)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4AWJ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4AWJ)

(-) Gene Ontology  (39, 58)

Asymmetric Unit(hide GO term definitions)
Chain A,D,G,J   (ELOB_HUMAN | Q15370)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process