Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  HUMAN CHYMASE - FYNOMER COMPLEX
 
Authors :  D. Schlatter, S. Brack, D. W. Banner, S. Batey, J. Benz, J. Bertschinger C. Joseph, A. Rufer, A. Van Der Kloosters, M. Weber, D. Grabulovski,
Date :  23 Jan 12  (Deposition) - 11 Jul 12  (Release) - 15 Aug 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Hydrolase-De Novo Protein Complex, Inhibitor, Serine Protease (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Schlatter, S. Brack, D. W. Banner, S. Batey, J. Benz, J. Bertschinger, W. Huber, C. Joseph, A. Rufer, A. Van Der Klooster, M. Weber, D. Grabulovski, M. Hennig
Generation, Characterization And Structural Data Of Chymase Binding Proteins Based On The Human Fyn Kinase Sh3 Domain.
Mabs V. 4 497 2012
PubMed-ID: 22653218  |  Reference-DOI: 10.4161/MABS.20452

(-) Compounds

Molecule 1 - CHYMASE
    ChainsA, B
    EC Number3.4.21.39
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymALPHA-CHYMASE, MAST CELL PROTEASE I
 
Molecule 2 - FYNOMER
    ChainsC, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificSYNTHETIC CONSTRUCT
    Organism Taxid32630

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A C 
Biological Unit 2 (1x) B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 10)

Asymmetric Unit (3, 10)
No.NameCountTypeFull Name
1LMR3Ligand/Ion(2S)-2-HYDROXYBUTANEDIOIC ACID
2MES2Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
3NA5Ligand/IonSODIUM ION
Biological Unit 1 (2, 3)
No.NameCountTypeFull Name
1LMR1Ligand/Ion(2S)-2-HYDROXYBUTANEDIOIC ACID
2MES2Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
3NA-1Ligand/IonSODIUM ION
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1LMR2Ligand/Ion(2S)-2-HYDROXYBUTANEDIOIC ACID
2MES-1Ligand/Ion2-(N-MORPHOLINO)-ETHANESULFONIC ACID
3NA-1Ligand/IonSODIUM ION

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS B:156 , ARG B:200 , LYS B:204 , PRO B:205 , HOH B:2130 , TYR C:9 , ASN C:54 , TYR C:55 , HOH C:2009 , HOH C:2058 , HOH C:2062BINDING SITE FOR RESIDUE MES C1060
02AC2SOFTWAREARG A:200 , LYS A:204 , PRO A:205 , HOH A:2171 , HOH A:2210 , HOH A:2228 , TYR D:9 , ASN D:54 , TYR D:55 , HOH D:2006 , HOH D:2037BINDING SITE FOR RESIDUE MES A1227
03AC3SOFTWAREPHE B:29 , HIS B:45 , LYS B:179 , GLY B:180 , SER B:182 , HOH B:2175 , TRP D:16BINDING SITE FOR RESIDUE LMR B1227
04AC4SOFTWAREARG A:158 , HIS B:156 , PHE B:157 , ARG B:200 , HOH B:2132 , HOH B:2177 , HOH B:2178 , HOH B:2179 , HOH C:2057 , THR D:14 , ARG D:15BINDING SITE FOR RESIDUE LMR B1228
05AC5SOFTWAREHIS A:156 , PHE A:157 , ARG A:200 , HOH A:2173 , HOH A:2207 , HOH A:2229 , HOH A:2230 , ARG B:158 , THR C:14 , ARG C:15BINDING SITE FOR RESIDUE LMR A1228
06AC6SOFTWAREGLU A:97 , LYS A:98 , GLY A:137 , ASP A:139 , HOH A:2058BINDING SITE FOR RESIDUE NA A1229
07AC7SOFTWAREHOH A:2114 , HOH A:2231 , HOH A:2232 , ARG B:158 , PHE B:160BINDING SITE FOR RESIDUE NA A1230
08AC8SOFTWAREHOH A:2196 , HOH A:2197 , HOH A:2198 , THR C:48 , HOH C:2052 , HOH C:2053BINDING SITE FOR RESIDUE NA C1061
09AC9SOFTWAREPHE B:114 , GLY D:32 , GLY D:35 , TRP D:38 , HOH D:2027 , HOH D:2028BINDING SITE FOR RESIDUE NA D1061
10BC1SOFTWAREARG A:158 , PHE A:160 , HOH A:2172 , HOH A:2176 , HOH A:2180 , SER B:84BINDING SITE FOR RESIDUE NA A1231

(-) SS Bonds  (6, 6)

Asymmetric Unit
No.Residues
1A:30 -A:46
2A:123 -A:188
3A:154 -A:167
4B:30 -B:46
5B:123 -B:188
6B:154 -B:167

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Pro A:205 -Pro A:206
2Pro B:205 -Pro B:206

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 6)

Asymmetric Unit (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_011770G46RCMA1_HUMANPolymorphism5246A/BG25R
2UniProtVAR_011771H66RCMA1_HUMANPolymorphism5247A/BH45R
3UniProtVAR_029190R98HCMA1_HUMANPolymorphism13306252A/BR77H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_011770G46RCMA1_HUMANPolymorphism5246AG25R
2UniProtVAR_011771H66RCMA1_HUMANPolymorphism5247AH45R
3UniProtVAR_029190R98HCMA1_HUMANPolymorphism13306252AR77H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_011770G46RCMA1_HUMANPolymorphism5246BG25R
2UniProtVAR_011771H66RCMA1_HUMANPolymorphism5247BH45R
3UniProtVAR_029190R98HCMA1_HUMANPolymorphism13306252BR77H

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 6)

Asymmetric Unit (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.CMA1_HUMAN22-245
 
  2A:1-224
B:1-224
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.CMA1_HUMAN62-67
 
  2A:41-46
B:41-46
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.CMA1_HUMAN197-208
 
  2A:176-187
B:176-187
Biological Unit 1 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.CMA1_HUMAN22-245
 
  1A:1-224
-
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.CMA1_HUMAN62-67
 
  1A:41-46
-
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.CMA1_HUMAN197-208
 
  1A:176-187
-
Biological Unit 2 (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.CMA1_HUMAN22-245
 
  1-
B:1-224
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.CMA1_HUMAN62-67
 
  1-
B:41-46
3TRYPSIN_SERPS00135 Serine proteases, trypsin family, serine active site.CMA1_HUMAN197-208
 
  1-
B:176-187

(-) Exons   (4, 8)

Asymmetric Unit (4, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002503781ENSE00001144725chr14:24977471-2497738488CMA1_HUMAN1-20200--
1.2aENST000002503782aENSE00001144738chr14:24976712-24976562151CMA1_HUMAN20-70512A:1-49
B:1-49
49
49
1.3ENST000002503783ENSE00000586440chr14:24975810-24975675136CMA1_HUMAN70-115462A:49-94
B:49-94
46
46
1.4aENST000002503784aENSE00000654524chr14:24975488-24975234255CMA1_HUMAN116-200852A:95-179 (gaps)
B:95-179
85
85
1.5bENST000002503785bENSE00001816406chr14:24974865-24974561305CMA1_HUMAN201-247472A:180-226
B:180-226
47
47

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:223
 aligned with CMA1_HUMAN | P23946 from UniProtKB/Swiss-Prot  Length:247

    Alignment length:226
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241      
           CMA1_HUMAN    22 IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 247
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee......eeeeeeeee..eeeehhhhh..eeeeee............eeeeeeeeee.............eeeee................---.......eeeeee..............eeeeeeeehhhhhh.........eeee................eeee..eeeeeeee........eeeeehhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------R-------------------R-------------------------------H----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: A:1-224 UniProt: 22-245                                                                                                                                                                                       -- PROSITE (1)
                PROSITE (2) ----------------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER --------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2a  PDB: A:1-49 UniProt: 20-70            ---------------------------------------------Exon 1.4a  PDB: A:95-179 (gaps) UniProt: 116-200                                     Exon 1.5b  PDB: A:180-226 UniProt: 201-247      Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------Exon 1.3  PDB: A:49-94 UniProt: 70-115        ------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 4ag2 A   1 IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFP---NFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 226
                                    10        20        30        40        50        60        70        80        90       100       110|   |  120       130       140       150       160       170       180       190       200       210       220      
                                                                                                                                        111 115                                                                                                               

Chain B from PDB  Type:PROTEIN  Length:226
 aligned with CMA1_HUMAN | P23946 from UniProtKB/Swiss-Prot  Length:247

    Alignment length:226
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241      
           CMA1_HUMAN    22 IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 247
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeeeee......eeeeeeeee..eeeehhhhh..eeeeee............eeeeeeeeee.............eeeee..........................eeeeee..............eeeeeeeehhhhhh.........eeee................eeee..eeeeeeee........eeeee...hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------R-------------------R-------------------------------H----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: B:1-224 UniProt: 22-245                                                                                                                                                                                       -- PROSITE (1)
                PROSITE (2) ----------------------------------------TRYPSI---------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER --------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.2a  PDB: B:1-49 UniProt: 20-70            ---------------------------------------------Exon 1.4a  PDB: B:95-179 UniProt: 116-200                                            Exon 1.5b  PDB: B:180-226 UniProt: 201-247      Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------Exon 1.3  PDB: B:49-94 UniProt: 70-115        ------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 4ag2 B   1 IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN 226
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220      

Chain C from PDB  Type:PROTEIN  Length:58
                                                                                          
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..................eeeeee.....eeeeee.....eeeee...eee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                 4ag2 C   2 VTLFVALYDYNATRWTDLSFHKGEKFQILDGDSGDWWEARSLTTGETGYIPSNYVAPV  59
                                    11        21        31        41        51        

Chain D from PDB  Type:PROTEIN  Length:58
                                                                                          
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..................eeeeee.....eeeeee.....eeeee...eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                 4ag2 D   3 TLFVALYDYNATRWTDLSFHKGEKFQILDGDSGDWWEARSLTTGETGYIPSNYVAPVD  60
                                    12        22        32        42        52        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4AG2)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4AG2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4AG2)

(-) Gene Ontology  (21, 21)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (CMA1_HUMAN | P23946)
molecular function
    GO:0004175    endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0042277    peptide binding    Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0002003    angiotensin maturation    The process leading to the attainment of the full functional capacity of angiotensin by conversion of renin substrate into mature angiotensin in the blood.
    GO:0071333    cellular response to glucose stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
    GO:0022617    extracellular matrix disassembly    A process that results in the breakdown of the extracellular matrix.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0050720    interleukin-1 beta biosynthetic process    The chemical reactions and pathways resulting in the formation of interleukin-1 beta.
    GO:0030901    midbrain development    The process whose specific outcome is the progression of the midbrain over time, from its formation to the mature structure. The midbrain is the middle division of the three primary divisions of the developing chordate brain or the corresponding part of the adult brain (in vertebrates, includes a ventral part containing the cerebral peduncles and a dorsal tectum containing the corpora quadrigemina and that surrounds the aqueduct of Sylvius connecting the third and fourth ventricles).
    GO:0006518    peptide metabolic process    The chemical reactions and pathways involving peptides, compounds of two or more amino acids where the alpha carboxyl group of one is bound to the alpha amino group of another.
    GO:0045766    positive regulation of angiogenesis    Any process that activates or increases angiogenesis.
    GO:0016485    protein processing    Any protein maturation process achieved by the cleavage of a peptide bond or bonds within a protein. Protein maturation is the process leading to the attainment of the full functional capacity of a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0050727    regulation of inflammatory response    Any process that modulates the frequency, rate or extent of the inflammatory response, the immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    LMR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MES  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:205 - Pro A:206   [ RasMol ]  
    Pro B:205 - Pro B:206   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4ag2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CMA1_HUMAN | P23946
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.39
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CMA1_HUMAN | P23946
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CMA1_HUMAN | P239461klt 1nn6 1pjp 1t31 2hvx 3n7o 3s0n 4afq 4afs 4afu 4afz 4ag1 4k2y 4k5z 4k60 4k69 4kp0

(-) Related Entries Specified in the PDB File

1klt CRYSTAL STRUCTURE OF PMSF-TREATED HUMAN CHYMASE AT 1. 9 ANGSTROMS RESOLUTION
1nn6 HUMAN PRO-CHYMASE
1pjp THE 2.2 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH SUCCINYL-ALA-ALA-PRO-PHE-CHLOROMETHYLKETONE
1t31 A DUAL INHIBITOR OF THE LEUKOCYTE PROTEASES CATHEPSIN G ANDCHYMASE WITH THERAPEUTIC EFFICACY IN ANIMALS MODELS OFINFLAMMATION
4afq HUMAN CHYMASE - FYNOMER COMPLEX
4afs HUMAN CHYMASE - FYNOMER COMPLEX
4afu HUMAN CHYMASE - FYNOMER COMPLEX
4afz HUMAN CHYMASE - FYNOMER COMPLEX
4ag1 HUMAN CHYMASE - FYNOMER COMPLEX