Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE WPL1 PROTEIN
 
Authors :  A. Chatterjee, S. Zakian, X. -W. Hu, M. R. Singleton
Date :  09 Jan 13  (Deposition) - 20 Feb 13  (Release) - 27 Mar 13  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.14
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Cell Cycle, Cohesin, Chromosome Segregation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Chatterjee, S. Zakian, X. -W. Hu, M. R. Singleton
Structural Insights Into Regulation Of Cohesion Establishment By Wpl1
Embo J. V. 32 677 2013
PubMed-ID: 23395900  |  Reference-DOI: 10.1038/EMBOJ.2013.16

(-) Compounds

Molecule 1 - WPL1
    Chains: A, B
    Fragment: RESIDUES 184-561
    Organism Scientific: EREMOTHECIUM GOSSYPII
    Organism Taxid: 33169
    Synonym: AAR187CP

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3ZIK)

(-) Sites  (0, 0)

(no "Site" information available for 3ZIK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3ZIK)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Arg B:361 -Gly B:362

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3ZIK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3ZIK)

(-) Exons   (0, 0)

(no "Exon" information available for 3ZIK)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:368
 aligned with Q75E93_ASHGO | Q75E93 from UniProtKB/TrEMBL  Length:561

    Alignment length:373
                                   198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558   
         Q75E93_ASHGO   189 RHFNELRTMGETLKYSEDLDFILSDNSMTTPEHRRNNMLRLCLDMMNNEDLCQYIVKYRHREVWEWCFQGTDPKQKVTSLLQCFIADKIPLLRHDKRWAMLSLENFILPLATDEVFPKKIAGSRLVKLNYQDLLRKLKFTNTCEYALYIWATYLLYTEAVYGAVPALARLISRGQLKDWDTACSLLENNIVAAPSGSDIEEYAQAFQTLAGLSREKLTNEGVLKCLIKLTNHTTVLELSADLLPSLVRSLAMSVQLHQNNIVSSISEIKTNLLILQLGLLLNIVSEATTAASTEELTNFGAVFRSVFVKKPTEMSFVLQLFLLVYAYSAGAAGVQLPPAEADFLKSELEAFATDVSSYNHNIHTRITRVLETL 561
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh.....hhhhhhh....hhhhhhh..........hhhhhhhhhhhhh.....hhhhhhhhhhhhhh.......hhhhhhhhhhhhh....hhhhhhhhhhh.....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh.-----hhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3zik A 189 RHFNELRTMGETLKYSEDLDFILSDNSMTTPEHRRNNMLRLCLDMMNNEDLCQYIVKYRHREVWEWCFQGTDPKQKVTSLLQCFIADKIPLLRHDKRWAMLSLENFILPLATDEVFPKKIAGSRLVKLNYQDLLRKLKFTNTCEYALYIWATYLLYTEAVYGAVPALARLISRGQLKDWDTACSLLENNIVAAPSGSDIEEYAQAFQTLAGLSREKLTNEGVLKCLIKLTNHTTVLELSADLLPSLVRSLAMSVQLHQNNIVSSISEIKTNLLILQLGLLLNIVSEATTAASTEELTNFGAVFRSVFVKKPTEMSFVLQLFLLVYAYSAGAAGVQLPPAEADFLKSELEAFATDV-----NIHTRITRVLETL 561
                                   198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528       538    |    -|      558   
                                                                                                                                                                                                                                                                                                                                                                                            543   549            


Chain B from PDB  Type:PROTEIN  Length:357
 aligned with Q75E93_ASHGO | Q75E93 from UniProtKB/TrEMBL  Length:561

    Alignment length:367
                                   204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       
         Q75E93_ASHGO   195 RTMGETLKYSEDLDFILSDNSMTTPEHRRNNMLRLCLDMMNNEDLCQYIVKYRHREVWEWCFQGTDPKQKVTSLLQCFIADKIPLLRHDKRWAMLSLENFILPLATDEVFPKKIAGSRLVKLNYQDLLRKLKFTNTCEYALYIWATYLLYTEAVYGAVPALARLISRGQLKDWDTACSLLENNIVAAPSGSDIEEYAQAFQTLAGLSREKLTNEGVLKCLIKLTNHTTVLELSADLLPSLVRSLAMSVQLHQNNIVSSISEIKTNLLILQLGLLLNIVSEATTAASTEELTNFGAVFRSVFVKKPTEMSFVLQLFLLVYAYSAGAAGVQLPPAEADFLKSELEAFATDVSSYNHNIHTRITRVLETL 561
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh.--------hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh.....hhhhhhh....hhhhhhh.........--hhhhhhhhhhhh.....hhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhhhhhhhh.....hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh.hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3zik B 195 RTMGETLKYSEDLDFILSD--------RRNNMLRLCLDMMNNEDLCQYIVKYRHREVWEWCFQGTDPKQKVTSLLQCFIADKIPLLRHDKRWAMLSLENFILPLATDEVFPKKIA--RLVKLNYQDLLRKLKFTNTCEYALYIWATYLLYTEAVYGAVPALARLISRGQLKDWDTACSLLENNIVAAPSGSDIEEYAQAFQTLAGLSREKLTNEGVLKCLIKLTNHTTVLELSADLLPSLVRSLAMSVQLHQNNIVSSISEIKTNLLILQLGLLLNIVSEATTAASTEELTNFGAVFRSVFVKKPTEMSFVLQLFLLVYAYSAGAAGVQLPPAEADFLKSELEAFATDVSSYNHNIHTRITRVLETL 561
                                   204        |-       224       234       244       254       264       274       284       294       304    |  314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494       504       514       524       534       544       554       
                                            213      222                                                                                    309  |                                                                                                                                                                                                                                                         
                                                                                                                                               312
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3ZIK)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3ZIK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3ZIK)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q75E93_ASHGO | Q75E93)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007064    mitotic sister chromatid cohesion    The cell cycle process in which the sister chromatids of a replicated chromosome are joined along the entire length of the chromosome, from their formation in S phase through metaphase during a mitotic cell cycle. This cohesion cycle is critical for high fidelity chromosome transmission.
    GO:1902340    negative regulation of chromosome condensation    Any process that stops, prevents or reduces the frequency, rate or extent of chromosome condensation.
    GO:0034183    negative regulation of maintenance of mitotic sister chromatid cohesion    Any process that decreases the extent to which the association between sister chromatids of a replicated chromosome is maintained during a mitotic cell cycle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3zik)
 
  Sites
(no "Sites" information available for 3zik)
 
  Cis Peptide Bonds
    Arg B:361 - Gly B:362   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3zik
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q75E93_ASHGO | Q75E93
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q75E93_ASHGO | Q75E93
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q75E93_ASHGO | Q75E93: 3zil

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3ZIK)