Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
(-)Biological Unit 9
(-)Biological Unit 10
(-)Biological Unit 11
(-)Biological Unit 12
(-)Biological Unit 13
(-)Biological Unit 14
(-)Biological Unit 15
(-)Biological Unit 16
(-)Biological Unit 17
(-)Biological Unit 18
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)
Image Biological Unit 9
Biological Unit 9  (Jmol Viewer)
Image Biological Unit 10
Biological Unit 10  (Jmol Viewer)
Image Biological Unit 11
Biological Unit 11  (Jmol Viewer)
Image Biological Unit 12
Biological Unit 12  (Jmol Viewer)
Image Biological Unit 13
Biological Unit 13  (Jmol Viewer)
Image Biological Unit 14
Biological Unit 14  (Jmol Viewer)
Image Biological Unit 15
Biological Unit 15  (Jmol Viewer)
Image Biological Unit 16
Biological Unit 16  (Jmol Viewer)
Image Biological Unit 17
Biological Unit 17  (Jmol Viewer)
Image Biological Unit 18
Biological Unit 18  (Jmol Viewer)

(-) Description

Title :  CRYSTALSTRUCTURE OF THE UBIQUITIN PROTEASE
 
Authors :  Y. Sato, S. Fukai
Date :  30 Jan 12  (Deposition) - 30 May 12  (Release) - 30 May 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.15
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E  (1x)
Biol. Unit 3:  F,G  (1x)
Biol. Unit 4:  H,I,J  (1x)
Biol. Unit 5:  K,L  (1x)
Biol. Unit 6:  M,N  (1x)
Biol. Unit 7:  O,P,Q  (1x)
Biol. Unit 8:  R,S  (1x)
Biol. Unit 9:  T,U  (1x)
Biol. Unit 10:  V,W,X  (1x)
Biol. Unit 11:  Y,Z  (1x)
Biol. Unit 12:  a,b  (1x)
Biol. Unit 13:  c,d,e  (1x)
Biol. Unit 14:  f,g  (1x)
Biol. Unit 15:  h,i  (1x)
Biol. Unit 16:  j,k,l  (1x)
Biol. Unit 17:  m,n  (1x)
Biol. Unit 18:  o,p  (1x)
Keywords :  Ubiquitin Protease, Hydrolase-Ligase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Sato, A. Yamagata, S. Goto-Ito, K. Kubota, K. Miyamoto, S. Nakada, S. Fukai
Molecular Basis Of K63-Linked Polyubiquitination Inhibition By The Interaction Between Human Deubiquitinating Enzyme Otub1 And Ubiquitin-Conjugating Enzyme Ubc13
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UBIQUITIN THIOESTERASE OTUB1
    ChainsA, H, O, V, c, j
    EC Number3.4.19.12
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET26B
    Expression System StrainROSETTA (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 45-271
    GeneHSPC263, OTB1, OTU1, OTUB1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDEUBIQUITINATING ENZYME OTUB1, OTU DOMAIN-CONTAINING UBIQUITIN ALDEHYDE-BINDING PROTEIN 1, OTUBAIN-1, HOTU1, UBIQUITIN- SPECIFIC-PROCESSING PROTEASE OTUB1
 
Molecule 2 - UBIQUITIN-CONJUGATING ENZYME E2 VARIANT 2
    ChainsB, D, F, I, K, M, P, R, T, W, Y, a, d, f, h, k, m, o
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET26B
    Expression System StrainROSETTA (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 6-143
    GeneMMS2, UBE2V2, UEV2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymDDVIT 1, ENTEROCYTE DIFFERENTIATION-ASSOCIATED FACTOR 1, EDAF-1, ENTEROCYTE DIFFERENTIATION-PROMOTING FACTOR 1, EDPF-1, MMS2 HOMOLOG, VITAMIN D3-INDUCIBLE PROTEIN
 
Molecule 3 - UBIQUITIN-CONJUGATING ENZYME E2 N
    ChainsC, E, G, J, L, N, Q, S, U, X, Z, b, e, g, i, l, n, p
    EC Number6.3.2.19
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET26B
    Expression System StrainROSETTA (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 3-150
    GeneBLU, UBC13, UBE2N
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymBENDLESS-LIKE UBIQUITIN-CONJUGATING ENZYME, UBC13, UBIQUITIN CARRIER PROTEIN N, UBIQUITIN-PROTEIN LIGASE N

 Structural Features

(-) Chains, Units

  123456789101112131415161718192021222324252627282930313233343536373839404142
Asymmetric Unit ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnop
Biological Unit 1 (1x)ABC                                       
Biological Unit 2 (1x)   DE                                     
Biological Unit 3 (1x)     FG                                   
Biological Unit 4 (1x)       HIJ                                
Biological Unit 5 (1x)          KL                              
Biological Unit 6 (1x)            MN                            
Biological Unit 7 (1x)              OPQ                         
Biological Unit 8 (1x)                 RS                       
Biological Unit 9 (1x)                   TU                     
Biological Unit 10 (1x)                     VWX                  
Biological Unit 11 (1x)                        YZ                
Biological Unit 12 (1x)                          ab              
Biological Unit 13 (1x)                            cde           
Biological Unit 14 (1x)                               fg         
Biological Unit 15 (1x)                                 hi       
Biological Unit 16 (1x)                                   jkl    
Biological Unit 17 (1x)                                      mn  
Biological Unit 18 (1x)                                        op

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3VON)

(-) Sites  (0, 0)

(no "Site" information available for 3VON)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3VON)

(-) Cis Peptide Bonds  (43, 43)

Asymmetric Unit
No.Residues
1Phe A:249 -Pro A:250
2Tyr B:73 -Pro B:74
3Tyr C:62 -Pro C:63
4Asn C:116 -Pro C:117
5Tyr D:73 -Pro D:74
6Tyr E:62 -Pro E:63
7Tyr F:73 -Pro F:74
8Tyr G:62 -Pro G:63
9Phe H:249 -Pro H:250
10Tyr I:73 -Pro I:74
11Tyr J:62 -Pro J:63
12Tyr K:73 -Pro K:74
13Tyr L:62 -Pro L:63
14Tyr M:73 -Pro M:74
15Tyr N:62 -Pro N:63
16Phe O:249 -Pro O:250
17Tyr P:73 -Pro P:74
18Tyr Q:62 -Pro Q:63
19Tyr R:73 -Pro R:74
20Tyr S:62 -Pro S:63
21Tyr T:73 -Pro T:74
22Tyr U:62 -Pro U:63
23Phe V:249 -Pro V:250
24Tyr W:73 -Pro W:74
25Tyr X:62 -Pro X:63
26Tyr Y:73 -Pro Y:74
27Tyr Z:62 -Pro Z:63
28Tyr a:73 -Pro a:74
29Tyr b:62 -Pro b:63
30Phe c:249 -Pro c:250
31Tyr d:73 -Pro d:74
32Tyr e:62 -Pro e:63
33Tyr f:73 -Pro f:74
34Tyr g:62 -Pro g:63
35Tyr h:73 -Pro h:74
36Tyr i:62 -Pro i:63
37Phe j:249 -Pro j:250
38Tyr k:73 -Pro k:74
39Tyr l:62 -Pro l:63
40Tyr m:73 -Pro m:74
41Tyr n:62 -Pro n:63
42Tyr o:73 -Pro o:74
43Tyr p:62 -Pro p:63

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 36)

Asymmetric Unit (2, 36)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776B/D/F/I/K/M/P/R/T/W/Y/a/d/f/h/k/m/oE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786B/D/F/I/K/M/P/R/T/W/Y/a/d/f/h/k/m/oP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776BE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786BP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776DE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786DP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776FE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786FP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776IE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786IP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 5 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776KE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786KP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 6 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776ME36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786MP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 7 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776PE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786PP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 8 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776RE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786RP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 9 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776TE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786TP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 10 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776WE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786WP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 11 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776YE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786YP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 12 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776aE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786aP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 13 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776dE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786dP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 14 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776fE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786fP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 15 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776hE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786hP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 16 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776kE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786kP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 17 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776mE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786mP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 18 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_052431E36GUB2V2_HUMANPolymorphism11557776oE36G
2UniProtVAR_052433P78QUB2V2_HUMANPolymorphism11557786oP78Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 60)

Asymmetric Unit (3, 60)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  18C:6-138
E:6-138
G:6-138
J:6-138
L:6-138
N:6-138
Q:6-138
S:6-138
U:6-138
X:6-138
Z:6-138
b:6-138
e:6-138
g:6-138
i:6-138
l:6-138
n:6-138
p:6-138
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  18B:13-138
D:13-138
F:13-138
I:13-138
K:13-138
M:13-138
P:13-138
R:13-138
T:13-138
W:13-138
Y:13-138
a:13-138
d:13-138
f:13-138
h:13-138
k:13-138
m:13-138
o:13-138
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  18C:76-91
E:76-91
G:76-91
J:76-91
L:76-91
N:76-91
Q:76-91
S:76-91
U:76-91
X:76-91
Z:76-91
b:76-91
e:76-91
g:76-91
i:76-91
l:76-91
n:76-91
p:76-91
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  6A:80-270
H:80-270
O:80-271
V:80-271
c:80-270
j:80-270
Biological Unit 1 (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1C:6-138
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1B:13-138
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1C:76-91
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  1A:80-270
-
-
-
-
-
Biological Unit 2 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
E:6-138
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
D:13-138
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
E:76-91
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 3 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
G:6-138
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
F:13-138
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
G:76-91
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 4 (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
J:6-138
-
-
-
-
-
-
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
I:13-138
-
-
-
-
-
-
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
J:76-91
-
-
-
-
-
-
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  1-
H:80-270
-
-
-
-
Biological Unit 5 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
L:6-138
-
-
-
-
-
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
K:13-138
-
-
-
-
-
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
L:76-91
-
-
-
-
-
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 6 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
N:6-138
-
-
-
-
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
M:13-138
-
-
-
-
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
N:76-91
-
-
-
-
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 7 (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
Q:6-138
-
-
-
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
P:13-138
-
-
-
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
Q:76-91
-
-
-
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  1-
-
O:80-271
-
-
-
Biological Unit 8 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
S:6-138
-
-
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
R:13-138
-
-
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
S:76-91
-
-
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 9 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
U:6-138
-
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
T:13-138
-
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
U:76-91
-
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 10 (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
X:6-138
-
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
W:13-138
-
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
X:76-91
-
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  1-
-
-
V:80-271
-
-
Biological Unit 11 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
Z:6-138
-
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
Y:13-138
-
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
Z:76-91
-
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 12 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
b:6-138
-
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
a:13-138
-
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
b:76-91
-
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 13 (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
e:6-138
-
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
d:13-138
-
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
e:76-91
-
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  1-
-
-
-
c:80-270
-
Biological Unit 14 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
g:6-138
-
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
f:13-138
-
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
g:76-91
-
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 15 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
i:6-138
-
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
h:13-138
-
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
i:76-91
-
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 16 (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
l:6-138
-
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
k:13-138
-
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
l:76-91
-
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  1-
-
-
-
-
j:80-270
Biological Unit 17 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
n:6-138
-
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
m:13-138
-
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
n:76-91
-
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-
Biological Unit 18 (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_CONJUGAT_2PS50127 Ubiquitin-conjugating enzymes family profile.UBE2N_HUMAN6-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
p:6-138
UB2V2_HUMAN13-138
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
o:13-138
2UBIQUITIN_CONJUGAT_1PS00183 Ubiquitin-conjugating enzymes active site.UBE2N_HUMAN76-91
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
  1-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
p:76-91
3OTUPS50802 OTU domain profile.OTUB1_HUMAN80-271
 
 
 
 
 
  0-
-
-
-
-
-

(-) Exons   (4, 72)

Asymmetric Unit (4, 72)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003180661ENSE00001277525chr12:93836026-93835631396UBE2N_HUMAN1-101018C:4-10
E:4-10
G:4-10
J:4-10
L:4-10
N:4-10
Q:4-10
S:3-10
U:4-10
X:4-10
Z:3-10
b:4-10
e:4-10
g:3-10
i:3-10
l:4-10
n:4-10
p:3-10
7
7
7
7
7
7
7
8
7
7
8
7
7
8
8
7
7
8
1.3ENST000003180663ENSE00001277541chr12:93805075-93804829247UBE2N_HUMAN11-938318C:11-93
E:11-93
G:11-93
J:11-93
L:11-93
N:11-93
Q:11-93
S:11-93
U:11-93
X:11-93
Z:11-93
b:11-93
e:11-93
g:11-93
i:11-93
l:11-93
n:11-93
p:11-93
83
83
83
83
83
83
83
83
83
83
83
83
83
83
83
83
83
83
1.4ENST000003180664ENSE00001277519chr12:93804650-93804510141UBE2N_HUMAN93-1404818C:93-140
E:93-140
G:93-140
J:93-140
L:93-140
N:93-140
Q:93-140
S:93-140
U:93-140
X:93-140
Z:93-140
b:93-140
e:93-140
g:93-140
i:93-140
l:93-140
n:93-140
p:93-140
48
48
48
48
48
48
48
48
48
48
48
48
48
48
48
48
48
48
1.5ENST000003180665ENSE00001277538chr12:93803855-938020901766UBE2N_HUMAN140-1521318C:140-150
E:140-150
G:140-150
J:140-150
L:140-150
N:140-150
Q:140-150
S:140-150
U:140-150
X:140-150
Z:140-150
b:140-150
e:140-150
g:140-150
i:140-150
l:140-150
n:140-150
p:140-150
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11
11

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:210
 aligned with OTUB1_HUMAN | Q96FW1 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:226
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264      
          OTUB1_HUMAN    45 NPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILY 270
               SCOP domains d3vona_ A: autom        ated matches                                                                                                                                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee.hhhhhh--------.hhhhhhhh...eee......hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhh........hhhhhhhhhhhhh..eeeee..--------.eee.......eeeeee..eeeeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------OTU  PDB: A:80-270 UniProt: 80-271                                                                                                                                                              PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von A  45 NPLVSERLELSVLYKE--------QQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMD--------PHIFPEGSEPKVYLLYRPGHYDILY 270
                                    54     |   -    |   74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234  |      - |     254       264      
                                          60       69                                                                                                                                                                     237      246                        

Chain B from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vonb_ B: Ubiquitin conjugating enzyme, UBC                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....ee............eeeeeee..........eeeeeee..........eeee....................hhhhhh.....hhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: B:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von B   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain C from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vonc_ C: automated matches                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: C:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: C:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: C:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von C   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain D from PDB  Type:PROTEIN  Length:137
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:137
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       
          UB2V2_HUMAN     7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vond_ D: Ubiquitin conjugating enzyme, UBC                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) -----------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------UBIQUITIN_CONJUGAT_2  PDB: D:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von D   7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       

Chain E from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vone_ E: automated matches                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: E:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: E:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: E:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von E   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain F from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vonf_ F: Ubiquitin conjugating enzyme, UBC                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee....................hhhhhh.....hhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: F:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von F   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain G from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vong_ G: automated matches                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: G:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: G:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: G:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von G   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain H from PDB  Type:PROTEIN  Length:214
 aligned with OTUB1_HUMAN | Q96FW1 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:226
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264      
          OTUB1_HUMAN    45 NPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILY 270
               SCOP domains d3vonh_ H: autom   ated matches                                                                                                                                                                                                    SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee.hhhh..---....hhhhhhhhhh...eee......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.......hhhhhhhhhhhh...eeee.---------..eee.......eeeeee..eeeeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------OTU  PDB: H:80-270 UniProt: 80-271                                                                                                                                                              PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von H  45 NPLVSERLELSVLYKE---DDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEY---------NPHIFPEGSEPKVYLLYRPGHYDILY 270
                                    54     |  64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234|        -|      254       264      
                                          60  64                                                                                                                                                                        235       245                         

Chain I from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3voni_ I: Ubiquitin conjugating enzyme, UBC                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee....................hhhhhh.....hhhhhhhhhhhh..hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: I:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von I   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain J from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vonj_ J: automated matches                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: J:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: J:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: J:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von J   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain K from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vonk_ K: Ubiquitin conjugating enzyme, UBC                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhhh.hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: K:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von K   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain L from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vonl_ L: automated matches                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: L:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: L:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: L:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von L   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain M from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vonm_ M: Ubiquitin conjugating enzyme, UBC                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: M:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von M   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain N from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vonn_ N: automated matches                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee............................hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: N:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: N:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: N:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von N   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain O from PDB  Type:PROTEIN  Length:216
 aligned with OTUB1_HUMAN | Q96FW1 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:227
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          OTUB1_HUMAN    45 NPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK 271
               SCOP domains d3vono_ O: automat   ed matches                                                                                                                                                                                                     SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee..hhhhhh.---...hhhhhhhhh...eee......hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.......hhhhhhhhhhhh...eeeee..--------.eee.......eeeeee..eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------OTU  PDB: O:80-271 UniProt: 80-271                                                                                                                                                               PROSITE (4)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von O  45 NPLVSERLELSVLYKEYA---NIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMD--------PHIFPEGSEPKVYLLYRPGHYDILYK 271
                                    54       | - |      74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234  |      - |     254       264       
                                            62  66                                                                                                                                                                        237      246                         

Chain P from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vonp_ P: Ubiquitin conjugating enzyme, UBC                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee....................hhhhhh.....hhhhhhhhhhhhh.hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: P:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von P   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain Q from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vonq_ Q: automated matches                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: Q:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: Q:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: Q:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von Q   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain R from PDB  Type:PROTEIN  Length:137
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:137
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       
          UB2V2_HUMAN     7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vonr_ R: Ubiquitin conjugating enzyme, UBC                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhh..hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -----------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------UBIQUITIN_CONJUGAT_2  PDB: R:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von R   7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       

Chain S from PDB  Type:PROTEIN  Length:148
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:148
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        
          UBE2N_HUMAN     3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vons_ S: automated matches                                                                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---UBIQUITIN_CONJUGAT_2  PDB: S:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.1Exon 1.3  PDB: S:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------Exon 1.4  PDB: S:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von S   3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        

Chain T from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vont_ T: Ubiquitin conjugating enzyme, UBC                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhh.................. Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: T:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von T   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain U from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vonu_ U: automated matches                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: U:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: U:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: U:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von U   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain V from PDB  Type:PROTEIN  Length:215
 aligned with OTUB1_HUMAN | Q96FW1 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:227
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       
          OTUB1_HUMAN    45 NPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILYK 271
               SCOP domains d3vonv_ V: autom     ated matches                                                                                                                                                                                                   SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee.hhhh..-----...hhhhhhhhh...eee......hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.......hhhhhhhhhhhh...eeeee..-------.eeee.......eeeeee..eeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------OTU  PDB: V:80-271 UniProt: 80-271                                                                                                                                                               PROSITE (4)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von V  45 NPLVSERLELSVLYKE-----NIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMD-------NPHIFPEGSEPKVYLLYRPGHYDILYK 271
                                    54     |   - |      74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234  |      -|      254       264       
                                          60    66                                                                                                                                                                        237     245                          

Chain W from PDB  Type:PROTEIN  Length:137
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:137
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       
          UB2V2_HUMAN     7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vonw_ W: Ubiquitin conjugating enzyme, UBC                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee....................hhhhhh.....hhhhhhhhhhhhh.hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -----------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------UBIQUITIN_CONJUGAT_2  PDB: W:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von W   7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       

Chain X from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vonx_ X: automated matches                                                                                                                        SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: X:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: X:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: X:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von X   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain Y from PDB  Type:PROTEIN  Length:137
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:137
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       
          UB2V2_HUMAN     7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains d3vony_ Y: Ubiquitin conjugating enzyme, UBC                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhhh.hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -----------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------UBIQUITIN_CONJUGAT_2  PDB: Y:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von Y   7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       

Chain Z from PDB  Type:PROTEIN  Length:148
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:148
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        
          UBE2N_HUMAN     3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains d3vonz_ Z: automated matches                                                                                                                         SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---UBIQUITIN_CONJUGAT_2  PDB: Z:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.1Exon 1.3  PDB: Z:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------Exon 1.4  PDB: Z:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von Z   3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        

Chain a from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: a:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von a   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain b from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: b:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: b:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: b:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von b   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain c from PDB  Type:PROTEIN  Length:217
 aligned with OTUB1_HUMAN | Q96FW1 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:226
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264      
          OTUB1_HUMAN    45 NPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILY 270
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee.hhhhhh-----..hhhhhhhhhh...eee......hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.......hhhhhhhhhhhhh..eeeee..----...eeeee.......eeeeee..eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------OTU  PDB: c:80-270 UniProt: 80-271                                                                                                                                                              PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von c  45 NPLVSERLELSVLYKE-----NIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMD----GTTNPHIFPEGSEPKVYLLYRPGHYDILY 270
                                    54     |   - |      74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234  |    244       254       264      
                                          60    66                                                                                                                                                                        237  242                            

Chain d from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....ee............eeeeeee..........eeeeeee..........eeee...............................hhhhhhhhhhhhh.hhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: d:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von d   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain e from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: e:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: e:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: e:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von e   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain f from PDB  Type:PROTEIN  Length:137
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:137
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       
          UB2V2_HUMAN     7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) -----------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------UBIQUITIN_CONJUGAT_2  PDB: f:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von f   7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       

Chain g from PDB  Type:PROTEIN  Length:148
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:148
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        
          UBE2N_HUMAN     3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---UBIQUITIN_CONJUGAT_2  PDB: g:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.1Exon 1.3  PDB: g:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------Exon 1.4  PDB: g:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von g   3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        

Chain h from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee....................hhhhhh.....hhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: h:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von h   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain i from PDB  Type:PROTEIN  Length:148
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:148
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        
          UBE2N_HUMAN     3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---UBIQUITIN_CONJUGAT_2  PDB: i:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.1Exon 1.3  PDB: i:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------Exon 1.4  PDB: i:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von i   3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        

Chain j from PDB  Type:PROTEIN  Length:210
 aligned with OTUB1_HUMAN | Q96FW1 from UniProtKB/Swiss-Prot  Length:271

    Alignment length:225
                                    55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265     
          OTUB1_HUMAN    46 PLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFPEGSEPKVYLLYRPGHYDILY 270
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......ee.hhhh..------....hhhhhhh...eee.......hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.......hhhhhhhhhhhh...eeee---------...eee.......eeeeee..eeeeee Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ----------------------------------OTU  PDB: j:80-270 UniProt: 80-271                                                                                                                                                              PROSITE (4)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von j  46 PLVSERLELSVLYKE------IYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVEKQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTVKEFCQQEVEPMCKESDHIHIIALAQALSVSIQVE---------TNPHIFPEGSEPKVYLLYRPGHYDILY 270
                                    55    |    - |      75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225        |-       245       255       265     
                                         60     67                                                                                                                                                                    234       244                          

Chain k from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee...............................hhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: k:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von k   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain l from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: l:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: l:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: l:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von l   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain m from PDB  Type:PROTEIN  Length:137
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:137
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       
          UB2V2_HUMAN     7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) -----------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------UBIQUITIN_CONJUGAT_2  PDB: m:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3von m   7 VKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       

Chain n from PDB  Type:PROTEIN  Length:147
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       
          UBE2N_HUMAN     4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh....eeeee......eeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --UBIQUITIN_CONJUGAT_2  PDB: n:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.1    Exon 1.3  PDB: n:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------Exon 1.4  PDB: n:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von n   4 LPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       

Chain o from PDB  Type:PROTEIN  Length:138
 aligned with UB2V2_HUMAN | Q15819 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:138
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        
          UB2V2_HUMAN     6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhh.....eeeee.........eeeeeee..........eeeeeee..........eeee................hhhhhhhhhh.....hhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ------------------------------G-----------------------------------------Q----------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------UBIQUITIN_CONJUGAT_2  PDB: o:13-138 UniProt: 13-138                                                                           ----- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3von o   6 GVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTY 143
                                    15        25        35        45        55        65        75        85        95       105       115       125       135        

Chain p from PDB  Type:PROTEIN  Length:148
 aligned with UBE2N_HUMAN | P61088 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:148
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        
          UBE2N_HUMAN     3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh....eeeeee..eeeeeeeeee..........eeeeeee..........eeee................hhhhh.......hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---UBIQUITIN_CONJUGAT_2  PDB: p:6-138 UniProt: 6-138                                                                                    ------------ PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------UBIQUITIN_CONJUG----------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) Exon 1.1Exon 1.3  PDB: p:11-93 UniProt: 11-93                                              ----------------------------------------------Exon 1.5    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------Exon 1.4  PDB: p:93-140 UniProt: 93-140         ---------- Transcript 1 (2)
                 3von p   3 GLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN 150
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 26)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3VON)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3VON)

(-) Gene Ontology  (63, 89)

Asymmetric Unit(hide GO term definitions)
Chain A,H,O,V,c,j   (OTUB1_HUMAN | Q96FW1)
molecular function
    GO:0019784    NEDD8-specific protease activity    Catalysis of the hydrolysis of NEDD8, a small ubiquitin-related modifier, from previously neddylated substrates.
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004843    thiol-dependent ubiquitin-specific protease activity    Catalysis of the thiol-dependent hydrolysis of a peptide bond formed by the C-terminal glycine of ubiquitin and another protein.
    GO:0036459    thiol-dependent ubiquitinyl hydrolase activity    Catalysis of the thiol-dependent hydrolysis of an ester, thioester, amide, peptide or isopeptide bond formed by the C-terminal glycine of ubiquitin.
    GO:0043130    ubiquitin binding    Interacting selectively and non-covalently with ubiquitin, a protein that when covalently bound to other cellular proteins marks them for proteolytic degradation.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0002250    adaptive immune response    An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0071347    cellular response to interleukin-1    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-1 stimulus.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:2000780    negative regulation of double-strand break repair    Any process that stops, prevents or reduces the frequency, rate or extent of double-strand break repair.
    GO:1901315    negative regulation of histone H2A K63-linked ubiquitination    Any process that stops, prevents or reduces the frequency, rate or extent of histone H2A K63-linked ubiquitination.
    GO:0071108    protein K48-linked deubiquitination    A protein deubiquitination process in which a K48-linked ubiquitin chain, i.e. a polymer of ubiquitin formed by linkages between lysine residues at position 48 of the ubiquitin monomers, is removed from a protein.
    GO:0016579    protein deubiquitination    The removal of one or more ubiquitin groups from a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,D,F,I,K,M,P,R,T,W,Y,a,d,f,h,k,m,o   (UB2V2_HUMAN | Q15819)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0061631    ubiquitin conjugating enzyme activity    Isoenergetic transfer of ubiquitin from one protein to another via the reaction X-ubiquitin + Y -> Y-ubiquitin + X, where both the X-ubiquitin and Y-ubiquitin linkages are thioester bonds between the C-terminal glycine of ubiquitin and a sulfhydryl side group of a cysteine residue.
    GO:0061630    ubiquitin protein ligase activity    Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0000729    DNA double-strand break processing    The 5' to 3' exonucleolytic resection of the DNA at the site of the break to form a 3' single-strand DNA overhang.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0006303    double-strand break repair via nonhomologous end joining    The repair of a double-strand break in DNA in which the two broken ends are rejoined with little or no sequence complementarity. Information at the DNA ends may be lost due to the modification of broken DNA ends. This term covers instances of separate pathways, called classical (or canonical) and alternative nonhomologous end joining (C-NHEJ and A-NHEJ). These in turn may further branch into sub-pathways, but evidence is still unclear.
    GO:0042275    error-free postreplication DNA repair    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA via processes such as template switching, which does not remove the replication-blocking lesions but does not increase the endogenous mutation rate.
    GO:0070911    global genome nucleotide-excision repair    The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
    GO:0043524    negative regulation of neuron apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
    GO:0045739    positive regulation of DNA repair    Any process that activates or increases the frequency, rate or extent of DNA repair.
    GO:0010976    positive regulation of neuron projection development    Any process that increases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
    GO:0032436    positive regulation of proteasomal ubiquitin-dependent protein catabolic process    Any process that activates or increases the frequency, rate or extent of the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
    GO:0051965    positive regulation of synapse assembly    Any process that activates, maintains or increases the frequency, rate or extent of synapse assembly, the aggregation, arrangement and bonding together of a set of components to form a synapse.
    GO:0006301    postreplication repair    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication. Includes pathways that remove replication-blocking lesions in conjunction with DNA replication.
    GO:0070534    protein K63-linked ubiquitination    A protein ubiquitination process in which a polymer of ubiquitin, formed by linkages between lysine residues at position 63 of the ubiquitin monomers, is added to a protein. K63-linked ubiquitination does not target the substrate protein for degradation, but is involved in several pathways, notably as a signal to promote error-free DNA postreplication repair.
    GO:0000209    protein polyubiquitination    Addition of multiple ubiquitin groups to a protein, forming a ubiquitin chain.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0006282    regulation of DNA repair    Any process that modulates the frequency, rate or extent of DNA repair.
cellular component
    GO:0031372    UBC13-MMS2 complex    A heterodimeric ubiquitin conjugating enzyme complex that catalyzes assembly of K63-linked polyubiquitin chains, which act as a signal to promote error-free DNA postreplication repair; in Saccharomyces the complex comprises Ubc13p and Mms2p.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,E,G,J,L,N,Q,S,U,X,Z,b,e,g,i,l,n,p   (UBE2N_HUMAN | P61088)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0043130    ubiquitin binding    Interacting selectively and non-covalently with ubiquitin, a protein that when covalently bound to other cellular proteins marks them for proteolytic degradation.
    GO:0061631    ubiquitin conjugating enzyme activity    Isoenergetic transfer of ubiquitin from one protein to another via the reaction X-ubiquitin + Y -> Y-ubiquitin + X, where both the X-ubiquitin and Y-ubiquitin linkages are thioester bonds between the C-terminal glycine of ubiquitin and a sulfhydryl side group of a cysteine residue.
    GO:0061630    ubiquitin protein ligase activity    Catalysis of the transfer of ubiquitin to a substrate protein via the reaction X-ubiquitin + S -> X + S-ubiquitin, where X is either an E2 or E3 enzyme, the X-ubiquitin linkage is a thioester bond, and the S-ubiquitin linkage is an amide bond: an isopeptide bond between the C-terminal glycine of ubiquitin and the epsilon-amino group of lysine residues in the substrate or, in the linear extension of ubiquitin chains, a peptide bond the between the C-terminal glycine and N-terminal methionine of ubiquitin residues.
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0000729    DNA double-strand break processing    The 5' to 3' exonucleolytic resection of the DNA at the site of the break to form a 3' single-strand DNA overhang.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0038095    Fc-epsilon receptor signaling pathway    A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
    GO:0050852    T cell receptor signaling pathway    A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0000724    double-strand break repair via homologous recombination    The error-free repair of a double-strand break in DNA in which the broken DNA molecule is repaired using homologous sequences. A strand in the broken DNA searches for a homologous region in an intact chromosome to serve as the template for DNA synthesis. The restoration of two intact DNA molecules results in the exchange, reciprocal or nonreciprocal, of genetic material between the intact DNA molecule and the broken DNA molecule.
    GO:0006303    double-strand break repair via nonhomologous end joining    The repair of a double-strand break in DNA in which the two broken ends are rejoined with little or no sequence complementarity. Information at the DNA ends may be lost due to the modification of broken DNA ends. This term covers instances of separate pathways, called classical (or canonical) and alternative nonhomologous end joining (C-NHEJ and A-NHEJ). These in turn may further branch into sub-pathways, but evidence is still unclear.
    GO:0070911    global genome nucleotide-excision repair    The nucleotide-excision repair process in which DNA lesions are removed from nontranscribed strands and from transcriptionally silent regions over the entire genome.
    GO:0016574    histone ubiquitination    The modification of histones by addition of ubiquitin groups.
    GO:0070423    nucleotide-binding oligomerization domain containing signaling pathway    Any series of molecular signals generated as a consequence of binding to a nucleotide-binding oligomerization domain containing (NOD) protein.
    GO:0045739    positive regulation of DNA repair    Any process that activates or increases the frequency, rate or extent of DNA repair.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0051092    positive regulation of NF-kappaB transcription factor activity    Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
    GO:0031058    positive regulation of histone modification    Any process that activates or increases the frequency, rate or extent of the covalent alteration of a histone.
    GO:0051443    positive regulation of ubiquitin-protein transferase activity    Any process that activates, maintains or increases the rate of ubiquitin transferase activity.
    GO:0006301    postreplication repair    The conversion of DNA-damage induced single-stranded gaps into large molecular weight DNA after replication. Includes pathways that remove replication-blocking lesions in conjunction with DNA replication.
    GO:0070534    protein K63-linked ubiquitination    A protein ubiquitination process in which a polymer of ubiquitin, formed by linkages between lysine residues at position 63 of the ubiquitin monomers, is added to a protein. K63-linked ubiquitination does not target the substrate protein for degradation, but is involved in several pathways, notably as a signal to promote error-free DNA postreplication repair.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006282    regulation of DNA repair    Any process that modulates the frequency, rate or extent of DNA repair.
    GO:0033182    regulation of histone ubiquitination    Any process that modulates the frequency, rate or extent of the addition of a ubiquitin group to a histone protein.
    GO:0002223    stimulatory C-type lectin receptor signaling pathway    Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
    GO:0006511    ubiquitin-dependent protein catabolic process    The chemical reactions and pathways resulting in the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of a ubiquitin group, or multiple ubiquitin groups, to the protein.
cellular component
    GO:0031372    UBC13-MMS2 complex    A heterodimeric ubiquitin conjugating enzyme complex that catalyzes assembly of K63-linked polyubiquitin chains, which act as a signal to promote error-free DNA postreplication repair; in Saccharomyces the complex comprises Ubc13p and Mms2p.
    GO:0035370    UBC13-UEV1A complex    A heterodimeric ubiquitin conjugating enzyme complex that catalyzes assembly of K63-linked polyubiquitin chains and is involved in NF-kappaB activation. In humans at least, the complex comprises the ubiquitin-conjugating enzyme UBC13 and ubiquitin-conjugating enzyme variant 1A (UEV1A).
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005730    nucleolus    A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0000151    ubiquitin ligase complex    A protein complex that includes a ubiquitin-protein ligase and enables ubiquitin protein ligase activity. The complex also contains other proteins that may confer substrate specificity on the complex.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3von)
 
  Sites
(no "Sites" information available for 3von)
 
  Cis Peptide Bonds
    Asn C:116 - Pro C:117   [ RasMol ]  
    Phe A:249 - Pro A:250   [ RasMol ]  
    Phe H:249 - Pro H:250   [ RasMol ]  
    Phe O:249 - Pro O:250   [ RasMol ]  
    Phe V:249 - Pro V:250   [ RasMol ]  
    Phe c:249 - Pro c:250   [ RasMol ]  
    Phe j:249 - Pro j:250   [ RasMol ]  
    Tyr B:73 - Pro B:74   [ RasMol ]  
    Tyr C:62 - Pro C:63   [ RasMol ]  
    Tyr D:73 - Pro D:74   [ RasMol ]  
    Tyr E:62 - Pro E:63   [ RasMol ]  
    Tyr F:73 - Pro F:74   [ RasMol ]  
    Tyr G:62 - Pro G:63   [ RasMol ]  
    Tyr I:73 - Pro I:74   [ RasMol ]  
    Tyr J:62 - Pro J:63   [ RasMol ]  
    Tyr K:73 - Pro K:74   [ RasMol ]  
    Tyr L:62 - Pro L:63   [ RasMol ]  
    Tyr M:73 - Pro M:74   [ RasMol ]  
    Tyr N:62 - Pro N:63   [ RasMol ]  
    Tyr P:73 - Pro P:74   [ RasMol ]  
    Tyr Q:62 - Pro Q:63   [ RasMol ]  
    Tyr R:73 - Pro R:74   [ RasMol ]  
    Tyr S:62 - Pro S:63   [ RasMol ]  
    Tyr T:73 - Pro T:74   [ RasMol ]  
    Tyr U:62 - Pro U:63   [ RasMol ]  
    Tyr W:73 - Pro W:74   [ RasMol ]  
    Tyr X:62 - Pro X:63   [ RasMol ]  
    Tyr Y:73 - Pro Y:74   [ RasMol ]  
    Tyr Z:62 - Pro Z:63   [ RasMol ]  
    Tyr a:73 - Pro a:74   [ RasMol ]  
    Tyr b:62 - Pro b:63   [ RasMol ]  
    Tyr d:73 - Pro d:74   [ RasMol ]  
    Tyr e:62 - Pro e:63   [ RasMol ]  
    Tyr f:73 - Pro f:74   [ RasMol ]  
    Tyr g:62 - Pro g:63   [ RasMol ]  
    Tyr h:73 - Pro h:74   [ RasMol ]  
    Tyr i:62 - Pro i:63   [ RasMol ]  
    Tyr k:73 - Pro k:74   [ RasMol ]  
    Tyr l:62 - Pro l:63   [ RasMol ]  
    Tyr m:73 - Pro m:74   [ RasMol ]  
    Tyr n:62 - Pro n:63   [ RasMol ]  
    Tyr o:73 - Pro o:74   [ RasMol ]  
    Tyr p:62 - Pro p:63   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]
    Biological Unit 9  [ Jena3D ]
    Biological Unit 10  [ Jena3D ]
    Biological Unit 11  [ Jena3D ]
    Biological Unit 12  [ Jena3D ]
    Biological Unit 13  [ Jena3D ]
    Biological Unit 14  [ Jena3D ]
    Biological Unit 15  [ Jena3D ]
    Biological Unit 16  [ Jena3D ]
    Biological Unit 17  [ Jena3D ]
    Biological Unit 18  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3von
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  OTUB1_HUMAN | Q96FW1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UB2V2_HUMAN | Q15819
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  UBE2N_HUMAN | P61088
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.19.12
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  6.3.2.19
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  OTUB1_HUMAN | Q96FW1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UB2V2_HUMAN | Q15819
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  UBE2N_HUMAN | P61088
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        OTUB1_HUMAN | Q96FW12zfy 4ddg 4ddi 4dhz 4i6l 4ldt
        UB2V2_HUMAN | Q158191j74 1j7d 1zgu 4nr3 4nrg 4nri 4onl 4onm 4onn 4orh 5ait
        UBE2N_HUMAN | P610881j7d 2c2v 3hct 3hcu 3w31 4dhi 4dhj 4dhz 4ip3 4nr3 4nrg 4nri 4onl 4onm 4onn 4orh 4tkp 4whv 5ait 5aiu 5eya

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3VON)