Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE EBOLAVIRUS PROTEIN VP24 FROM SUDAN
 
Authors :  A. P. P. Zhang
Date :  12 Jan 12  (Deposition) - 18 Apr 12  (Release) - 18 Apr 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Ebolavirus, Interferon Antagonist, Vp24, Stat1, Zaire, Sudan, Reston, Vp35, Karyopherin Alpha, Ifn Response Pathway, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. P. P. Zhang, Z. A. Bornholdt, T. Liu, D. M. Abelson, D. E. Lee, S. Li, V. L. Woods Jr. , E. O. Saphire
The Ebola Virus Interferon Antagonist Vp24 Directly Binds Stat1 And Has A Novel, Pyramidal Fold
Plos Pathog. V. 8 02550 2012
PubMed-ID: 22383882  |  Reference-DOI: 10.1371/JOURNAL.PPAT.1002550

(-) Compounds

Molecule 1 - MEMBRANE-ASSOCIATED PROTEIN VP24
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 13-228
    Gene: VP24
    Mutation: YES
    Organism Scientific: SUDAN EBOLAVIRUS
    Organism Taxid: 186540
    Synonym: MINOR MATRIX PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (1x): A
Biological Unit 2 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3VNF)

(-) Sites  (0, 0)

(no "Site" information available for 3VNF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3VNF)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Arg A:212 -His A:213

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3VNF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3VNF)

(-) Exons   (0, 0)

(no "Exon" information available for 3VNF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:199
 aligned with B0LPM0_9MONO | B0LPM0 from UniProtKB/TrEMBL  Length:251

    Alignment length:216
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222      
         B0LPM0_9MONO    13 PKRELEQGVVFSDLCNFLVTPTVQGWKVYWAGLEFDVNQKGITLLNRLKVNDFAPAWAMTRNLFPHLFKNQQSEVQTPIWALRVILAAGILDQLMDHSLIEPLSGALNLIADWLLTTSTNHFNMRTQRVKDQLSMRMLSLIRSNIINFINKLETLHVVNYKGLLSSVEIGTPSYAIIITRTNMGYLVEVQEPDKSAMDIRHPGPVKFSLLHESTLK 228
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh..eeee...eeeeee..eeeeee..hhhhhhhhh---------.hhhhhhhhhh...eee.hhhhhhhhhhhhhhhhhhh------.hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........eeeee....eeeeeee..eeeeeee.......--.....eeeeeehhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3vnf A  13 PKRELEQGVAFSDLCNFLVTPTVQGWKVYWAGLEFDVNQKGITLLNRLK---------MTRNLFPHLFKNQQSEVQTPIWALRVILAAGILDQLM------PLSGALNLIADWLLTTSTNHFNMRTQRVKDQLSMRMLSLIRSNIINFINKLETLHVVNYKGLLSSVEIGTPSYAIIITRTNMGYLVEVQEPDKSAM--RHPGPVKFSLLHESTLK 228
                                    22        32        42        52        |-        72        82        92       102    |    - |     122       132       142       152       162       172       182       192       202      |212       222      
                                                                           61        71                                 107    114                                                                                            209  |                
                                                                                                                                                                                                                                 212                


Chain A from PDB  Type:PROTEIN  Length:199
 aligned with VP24_EBOSU | Q5XX02 from UniProtKB/Swiss-Prot  Length:251

    Alignment length:216
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222      
           VP24_EBOSU    13 PKRELEQGVVFSDLCNFLVTPTVQGWKVYWAGLEFDVNQKGITLLNRLKVNDFAPAWAMTRNLFPHLFKNQQSEVQTPIWALRVILAAGILDQLMDHSLIEPLSGALNLIADWLLTTSTNHFNMRTQRVKDQLSMRMLSLIRSNIINFINKLETLHVVNYKGLLSSVEIGTPSYAIIITRTNMGYLVEVQEPDKSAMDIRHPGPVKFSLLHESTLK 228
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh..eeee...eeeeee..eeeeee..hhhhhhhhh---------.hhhhhhhhhh...eee.hhhhhhhhhhhhhhhhhhh------.hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...........eeeee....eeeeeee..eeeeeee.......--.....eeeeeehhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3vnf A  13 PKRELEQGVAFSDLCNFLVTPTVQGWKVYWAGLEFDVNQKGITLLNRLK---------MTRNLFPHLFKNQQSEVQTPIWALRVILAAGILDQLM------PLSGALNLIADWLLTTSTNHFNMRTQRVKDQLSMRMLSLIRSNIINFINKLETLHVVNYKGLLSSVEIGTPSYAIIITRTNMGYLVEVQEPDKSAM--RHPGPVKFSLLHESTLK 228
                                    22        32        42        52        |-        72        82        92       102    |    - |     122       132       142       152       162       172       182       192       202      |212       222      
                                                                           61        71                                 107    114                                                                                            209  |                
                                                                                                                                                                                                                                 212
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3VNF)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3VNF)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3VNF)

(-) Gene Ontology  (9, 17)

Asymmetric Unit(hide GO term definitions)
Chain A   (VP24_EBOSU | Q5XX02)
molecular function
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0030683    evasion or tolerance by virus of host immune response    Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0033645    host cell endomembrane system    A collection of membranous structures involved in transport within the host cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0020002    host cell plasma membrane    The plasma membrane surrounding a host cell.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.
    GO:0055036    virion membrane    The lipid bilayer surrounding a virion.

Chain A   (B0LPM0_9MONO | B0LPM0)
molecular function
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
biological process
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0033645    host cell endomembrane system    A collection of membranous structures involved in transport within the host cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0020002    host cell plasma membrane    The plasma membrane surrounding a host cell.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.
    GO:0055036    virion membrane    The lipid bilayer surrounding a virion.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3vnf)
 
  Sites
(no "Sites" information available for 3vnf)
 
  Cis Peptide Bonds
    Arg A:212 - His A:213   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3vnf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B0LPM0_9MONO | B0LPM0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  VP24_EBOSU | Q5XX02
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B0LPM0_9MONO | B0LPM0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  VP24_EBOSU | Q5XX02
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        B0LPM0_9MONO | B0LPM0: 3vne
        VP24_EBOSU | Q5XX02: 3vne

(-) Related Entries Specified in the PDB File

3vne 4d9o