Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF BMX NON-RECEPTOR TYROSINE KINASE COMPLEX WITH DASATINIB
 
Authors :  J. Sack, J. Muckelbauer
Date :  15 Jul 11  (Deposition) - 21 Sep 11  (Release) - 30 Nov 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A,B  (1x)
Keywords :  Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Muckelbauer, J. S. Sack, N. Ahmed, J. Burke, C. Y. Chang, M. Gao, J. Tino, D. Xie, A. J. Tebben
X-Ray Crystal Structure Of Bone Marrow Kinase In The X Chromosome: A Tec Family Kinase.
Chem. Biol. Drug Des. V. 78 739 2011
PubMed-ID: 21883956  |  Reference-DOI: 10.1111/J.1747-0285.2011.01230.X

(-) Compounds

Molecule 1 - CYTOPLASMIC TYROSINE-PROTEIN KINASE BMX
    ChainsA, B
    EC Number2.7.10.2
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF9
    Expression System CommonFALL ARMYWORM
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentUNP RESIDUES 411-675
    GeneAGMX1, ATK, BMX, BPK, BTK
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymBONE MARROW TYROSINE KINASE GENE IN CHROMOSOME X PROTEIN, EPITHELIAL AND ENDOTHELIAL TYROSINE KINASE, ETK, NTK38

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B
Biological Unit 3 (1x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric Unit (2, 5)
No.NameCountTypeFull Name
11N12Ligand/IonN-(2-CHLORO-6-METHYLPHENYL)-2-({6-[4-(2-HYDROXYETHYL)PIPERAZIN-1-YL]-2-METHYLPYRIMIDIN-4-YL}AMINO)-1,3-THIAZOLE-5-CARBOXAMIDE
2SO43Ligand/IonSULFATE ION
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
11N11Ligand/IonN-(2-CHLORO-6-METHYLPHENYL)-2-({6-[4-(2-HYDROXYETHYL)PIPERAZIN-1-YL]-2-METHYLPYRIMIDIN-4-YL}AMINO)-1,3-THIAZOLE-5-CARBOXAMIDE
2SO41Ligand/IonSULFATE ION
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
11N11Ligand/IonN-(2-CHLORO-6-METHYLPHENYL)-2-({6-[4-(2-HYDROXYETHYL)PIPERAZIN-1-YL]-2-METHYLPYRIMIDIN-4-YL}AMINO)-1,3-THIAZOLE-5-CARBOXAMIDE
2SO42Ligand/IonSULFATE ION
Biological Unit 3 (2, 5)
No.NameCountTypeFull Name
11N12Ligand/IonN-(2-CHLORO-6-METHYLPHENYL)-2-({6-[4-(2-HYDROXYETHYL)PIPERAZIN-1-YL]-2-METHYLPYRIMIDIN-4-YL}AMINO)-1,3-THIAZOLE-5-CARBOXAMIDE
2SO43Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:423 , VAL A:431 , ALA A:443 , LYS A:445 , ILE A:487 , THR A:489 , GLU A:490 , TYR A:491 , ILE A:492 , SER A:493 , GLY A:495 , SER A:553 , PHE A:555 , LEU B:420BINDING SITE FOR RESIDUE 1N1 A 1
2AC2SOFTWAREHOH A:81 , HOH A:115 , HOH A:148 , TYR A:586 , SER A:607 , LYS A:610 , TYR A:632 , PRO A:634 , HIS A:635BINDING SITE FOR RESIDUE SO4 A 676
3AC3SOFTWAREHOH B:116 , HOH B:157 , LEU B:423 , VAL B:431 , ALA B:443 , LYS B:445 , ILE B:487 , THR B:489 , GLU B:490 , TYR B:491 , ILE B:492 , SER B:493 , GLY B:495 , SER B:553 , PHE B:555BINDING SITE FOR RESIDUE 1N1 B 2
4AC4SOFTWAREVAL A:567 , SER A:568 , HOH B:227 , GLY B:408 , HIS B:409 , MET B:410 , GLU B:411BINDING SITE FOR RESIDUE SO4 B 676
5AC5SOFTWARELYS B:610 , TYR B:632 , PRO B:634 , HIS B:635BINDING SITE FOR RESIDUE SO4 B 3

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3SXR)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Tyr A:483 -Pro A:484
2Tyr B:483 -Pro B:484

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041675R670WBMX_HUMANUnclassified  ---A/BR670W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041675R670WBMX_HUMANUnclassified  ---AR670W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041675R670WBMX_HUMANUnclassified  ---BR670W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_041675R670WBMX_HUMANUnclassified  ---A/BR670W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.BMX_HUMAN423-445
 
  2A:423-445
B:423-445
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.BMX_HUMAN532-544
 
  2A:532-544
B:532-544
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.BMX_HUMAN423-445
 
  1A:423-445
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.BMX_HUMAN532-544
 
  1A:532-544
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.BMX_HUMAN423-445
 
  1-
B:423-445
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.BMX_HUMAN532-544
 
  1-
B:532-544
Biological Unit 3 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.BMX_HUMAN423-445
 
  2A:423-445
B:423-445
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.BMX_HUMAN532-544
 
  2A:532-544
B:532-544

(-) Exons   (7, 14)

Asymmetric Unit (7, 14)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003576071ENSE00001415013X:15482369-15482547179BMX_HUMAN-00--
1.4bENST000003576074bENSE00000857421X:15526468-15526614147BMX_HUMAN1-46460--
1.5ENST000003576075ENSE00000665881X:15527452-15527556105BMX_HUMAN47-81350--
1.6ENST000003576076ENSE00000665880X:15529560-1552964182BMX_HUMAN82-109280--
1.7ENST000003576077ENSE00000665879X:15534235-15534354120BMX_HUMAN109-149410--
1.8bENST000003576078bENSE00000665878X:15536052-1553611665BMX_HUMAN149-170220--
1.9ENST000003576079ENSE00000665876X:15540469-15540710242BMX_HUMAN171-251810--
1.10ENST0000035760710ENSE00000665875X:15543411-1554348878BMX_HUMAN251-277270--
1.11ENST0000035760711ENSE00000665874X:15544165-1554421854BMX_HUMAN277-295190--
1.12ENST0000035760712ENSE00000665873X:15548096-1554815055BMX_HUMAN295-313190--
1.13ENST0000035760713ENSE00000665872X:15549451-1554953080BMX_HUMAN314-340270--
1.14ENST0000035760714ENSE00000665871X:15552335-15552462128BMX_HUMAN340-383440--
1.15ENST0000035760715ENSE00000665870X:15554476-1555455075BMX_HUMAN383-408262A:408-408
B:408-408
1
1
1.16ENST0000035760716ENSE00000665869X:15555257-15555428172BMX_HUMAN408-465582A:408-465 (gaps)
B:408-465 (gaps)
58
58
1.17aENST0000035760717aENSE00000665868X:15560105-15560321217BMX_HUMAN465-537732A:465-537
B:465-537
73
73
1.18bENST0000035760718bENSE00000665867X:15561194-1556125865BMX_HUMAN538-559222A:538-559
B:538-559
22
22
1.19ENST0000035760719ENSE00000665865X:15564926-15565044119BMX_HUMAN559-599412A:559-599
B:559-599
41
41
1.20ENST0000035760720ENSE00001434621X:15567963-15568120158BMX_HUMAN599-651532A:599-651
B:599-651
53
53
1.21bENST0000035760721bENSE00001484764X:15574196-15574652457BMX_HUMAN652-675242A:652-671
B:652-671
20
20

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:260
 aligned with BMX_HUMAN | P51813 from UniProtKB/Swiss-Prot  Length:675

    Alignment length:264
                                   417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667    
            BMX_HUMAN   408 GIWELKREEITLLKELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLRE 671
               SCOP domains d3sxra_ A: automat    ed matches                                                                                                                                                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhh.eeeeeeee.----.eeeeee...eeeeeeee.....hhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee...hhh.eee.....eee.....eee.....eee......hhhhhhhhhhhhheee.hhhhhhhhhhhhhhhh.........hhhhhhhhhhhh.........hhhhhhhhhhh...hhhhh.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W- SAPs(SNPs)
                    PROSITE ---------------PROTEIN_KINASE_ATP     --------------------------------------------------------------------------------------PROTEIN_KINAS------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1--------------------------------------------------------Exon 1.17a  PDB: A:465-537 UniProt: 465-537                              Exon 1.18b            ---------------------------------------Exon 1.20  PDB: A:599-651 UniProt: 599-651           Exon 1.21b           Transcript 1 (1)
           Transcript 1 (2) Exon 1.16  PDB: A:408-465 (gaps) UniProt: 408-465         ---------------------------------------------------------------------------------------------Exon 1.19  PDB: A:559-599                ------------------------------------------------------------------------ Transcript 1 (2)
                 3sxr A 408 GHMELKREEITLLKELGS----VVKLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKMPYDLYTNSEVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLRE 671
                                   417       | -  |    437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667    
                                           425  430                                                                                                                                                                                                                                                 

Chain B from PDB  Type:PROTEIN  Length:258
 aligned with BMX_HUMAN | P51813 from UniProtKB/Swiss-Prot  Length:675

    Alignment length:264
                                   417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667    
            BMX_HUMAN   408 GIWELKREEITLLKELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLRE 671
               SCOP domains d3sxrb_ B: autom      ated matches                                                                                                                                                                                                                                       SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhh.eeeeee.------.eeeeee...eeeeeeee.....hhhhhhhhhhhhhhh.......eeeee.....eeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee...hhh.eee.....eee.....eee.....eee......hhhhhhhhhhh..eee.hhhhhhhhhhhhhhhh.........hhhhhhhhhhhh.........hhhhhhhhhhh...hhhhh.hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W- SAPs(SNPs)
                    PROSITE ---------------PROTEIN_KINASE_ATP     --------------------------------------------------------------------------------------PROTEIN_KINAS------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1--------------------------------------------------------Exon 1.17a  PDB: B:465-537 UniProt: 465-537                              Exon 1.18b            ---------------------------------------Exon 1.20  PDB: B:599-651 UniProt: 599-651           Exon 1.21b           Transcript 1 (1)
           Transcript 1 (2) Exon 1.16  PDB: B:408-465 (gaps) UniProt: 408-465         ---------------------------------------------------------------------------------------------Exon 1.19  PDB: B:559-599                ------------------------------------------------------------------------ Transcript 1 (2)
                 3sxr B 408 GHMELKREEITLLKEL------VVKLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKMPYDLYTNSEVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLRE 671
                                   417     |   -  |    437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667    
                                         423    430                                                                                                                                                                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3SXR)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3SXR)

(-) Gene Ontology  (29, 29)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (BMX_HUMAN | P51813)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0004715    non-membrane spanning protein tyrosine kinase activity    Catalysis of the reaction: ATP + protein L-tyrosine = ADP + protein L-tyrosine phosphate by a non-membrane spanning protein.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0001865    NK T cell differentiation    The process in which a precursor cell type acquires the specialized features of a NK T cell.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007155    cell adhesion    The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
    GO:0006921    cellular component disassembly involved in execution phase of apoptosis    The breakdown of structures such as organelles, proteins, or other macromolecular structures during apoptosis.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0007498    mesoderm development    The process whose specific outcome is the progression of the mesoderm over time, from its formation to the mature structure. The mesoderm is the middle germ layer that develops into muscle, bone, cartilage, blood and connective tissue.
    GO:0038083    peptidyl-tyrosine autophosphorylation    The phosphorylation by a protein of one or more of its own tyrosine amino acid residues, or a tyrosine residue on an identical protein.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0031234    extrinsic component of cytoplasmic side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
    GO:0032587    ruffle membrane    The portion of the plasma membrane surrounding a ruffle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    1N1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Tyr A:483 - Pro A:484   [ RasMol ]  
    Tyr B:483 - Pro B:484   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3sxr
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BMX_HUMAN | P51813
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BMX_HUMAN | P51813
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BMX_HUMAN | P518132ekx 2ys2 3sxs

(-) Related Entries Specified in the PDB File

3sxs