Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A LEUCINE-RICH REPEAT PROTEIN (BT_1240) FROM BACTEROIDES THETAIOTAOMICRON VPI-5482 AT 1.99 A RESOLUTION
 
Authors :  Joint Center For Structural Genomics (Jcsg)
Date :  03 Jun 11  (Deposition) - 22 Jun 11  (Release) - 24 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.99
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A,B  (1x)
Keywords :  Lrr, Right-Handed Beta-Alpha Superhelix, Leucine-Rich Repeat, Structural Genomics, Joint Center For Structural Genomics, Jcsg, Protein Structure Initiative, Psi-Biology, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Joint Center For Structural Genomics (Jcsg)
Crystal Structure Of A Hypothetical Leucine Rich Repeat Protein (Bt_1240) From Bacteroides Thetaiotaomicron Vpi-548 At 1. 99 A Resolution
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL LEUCINE RICH REPEAT PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidSPEEDET
    Expression System StrainHK100
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentSEQUENCE DATABASE RESIDUES 22-349
    GeneBT_1240
    Organism ScientificBACTEROIDES THETAIOTAOMICRON
    Organism Taxid818

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B
Biological Unit 3 (1x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 30)

Asymmetric Unit (3, 30)
No.NameCountTypeFull Name
1GOL13Ligand/IonGLYCEROL
2MSE16Mod. Amino AcidSELENOMETHIONINE
3PG41Ligand/IonTETRAETHYLENE GLYCOL
Biological Unit 1 (2, 17)
No.NameCountTypeFull Name
1GOL9Ligand/IonGLYCEROL
2MSE8Mod. Amino AcidSELENOMETHIONINE
3PG4-1Ligand/IonTETRAETHYLENE GLYCOL
Biological Unit 2 (3, 13)
No.NameCountTypeFull Name
1GOL4Ligand/IonGLYCEROL
2MSE8Mod. Amino AcidSELENOMETHIONINE
3PG41Ligand/IonTETRAETHYLENE GLYCOL
Biological Unit 3 (3, 30)
No.NameCountTypeFull Name
1GOL13Ligand/IonGLYCEROL
2MSE16Mod. Amino AcidSELENOMETHIONINE
3PG41Ligand/IonTETRAETHYLENE GLYCOL

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:30 , LYS A:55 , HOH A:586BINDING SITE FOR RESIDUE GOL A 351
02AC2SOFTWARETYR A:91 , TYR A:107 , ASN B:185BINDING SITE FOR RESIDUE GOL A 353
03AC3SOFTWARELYS A:274 , ILE A:275 , LEU A:295 , ALA A:296 , THR A:298 , LEU A:299BINDING SITE FOR RESIDUE GOL A 354
04AC4SOFTWAREGLY A:115 , THR A:117 , LYS A:141 , HIS B:189BINDING SITE FOR RESIDUE GOL A 355
05AC5SOFTWAREGLU A:211 , TYR A:244BINDING SITE FOR RESIDUE GOL A 357
06AC6SOFTWAREGLU A:124 , LYS A:147 , GLU A:199BINDING SITE FOR RESIDUE GOL A 358
07AC7SOFTWARELYS A:125 , ILE A:148 , PRO A:197 , LEU A:198 , GLU A:199BINDING SITE FOR RESIDUE GOL A 359
08AC8SOFTWAREARG A:320 , TYR A:321 , HOH A:635 , HOH A:767BINDING SITE FOR RESIDUE GOL A 361
09AC9SOFTWAREASP A:234 , ASN A:235 , ALA A:236 , HOH A:686BINDING SITE FOR RESIDUE GOL A 362
10BC1SOFTWAREGLU B:211 , PRO B:221 , TYR B:244 , HOH B:756BINDING SITE FOR RESIDUE GOL B 350
11BC2SOFTWARELYS B:147 , LEU B:227 , SER B:250 , ASP B:252BINDING SITE FOR RESIDUE GOL B 352
12BC3SOFTWAREMSE B:100 , PHE B:103BINDING SITE FOR RESIDUE GOL B 356
13BC4SOFTWARELYS B:270 , TYR B:271 , ARG B:294 , HOH B:592BINDING SITE FOR RESIDUE GOL B 360
14BC5SOFTWAREGLU A:41 , GLU A:59 , ARG A:62 , HIS A:63 , HOH A:666 , LYS B:255 , THR B:256 , ASN B:257 , THR B:259 , HIS B:279 , ASN B:280BINDING SITE FOR RESIDUE PG4 B 363

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3SB4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3SB4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3SB4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3SB4)

(-) Exons   (0, 0)

(no "Exon" information available for 3SB4)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:329
 aligned with Q8A8C7_BACTN | Q8A8C7 from UniProtKB/TrEMBL  Length:349

    Alignment length:329
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340         
         Q8A8C7_BACTN    21 AQVSKTYYVSKPGTLISMMTEEEANSITHLTLTGKLNAEDFRHLRDEFPSLKVLDISNAEIKMYSGKAGTYPNGKFYIYMANFVPAYAFSNVVNGVTKGKQTLEKVILSEKIKNIEDAAFKGCDNLKICQIRKKTAPNLLPEALADSVTAIFIPLGSSDAYRFKNRWEHFAFIEGEPLETTIQVGAMGKLEDEIMKAGLQPRDINFLTIEGKLDNADFKLIRDYMPNLVSLDISKTNATTIPDFTFAQKKYLLKIKLPHNLKTIGQRVFSNCGRLAGTLELPASVTAIEFGAFMGCDNLRYVLATGDKITTLGDELFGNGVPSKLIYKK 349
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....hhhhhhhhhhhhhh.eeeeeeeehhhhhhhhhhh.....eeeeeeeee..eee....hhhhh.eee...ee.....eeee..eeee.....eeee.....ee............eeee......ee..........eeee....hhhhhh........eee....eeeeee....hhhhhhhhh..hhhhh.eeeeee..hhhhhhhhhhhh....eee.......ee............eee......ee............eeeee.....ee..........eeeeee......ee............eee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sb4 A   0 GQVSKTYYVSKPGTLISmmTEEEANSITHLTLTGKLNAEDFRHLRDEFPSLKVLDISNAEIKmYSGKAGTYPNGKFYIYmANFVPAYAFSNVVNGVTKGKQTLEKVILSEKIKNIEDAAFKGCDNLKICQIRKKTAPNLLPEALADSVTAIFIPLGSSDAYRFKNRWEHFAFIEGEPLETTIQVGAmGKLEDEImKAGLQPRDINFLTIEGKLDNADFKLIRDYmPNLVSLDISKTNATTIPDFTFAQKKYLLKIKLPHNLKTIGQRVFSNCGRLAGTLELPASVTAIEFGAFmGCDNLRYVLATGDKITTLGDELFGNGVPSKLIYKK 349
                            ||      30       |40        50        60        70        80  |     90       100       110       120       130       140       150       160       170       180       190       200      |210    |  220       230       240    |  250       260       270       280       290       300       310   |   320       330       340         
                            ||              38-MSE                                       83-MSE          100-MSE                                                                                                    207-MSE 215-MSE                       245-MSE                                                              314-MSE                               
                            0|               39-MSE                                                                                                                                                                                                                                                                                                                  
                            22                                                                                                                                                                                                                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:328
 aligned with Q8A8C7_BACTN | Q8A8C7 from UniProtKB/TrEMBL  Length:349

    Alignment length:328
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341        
         Q8A8C7_BACTN    22 QVSKTYYVSKPGTLISMMTEEEANSITHLTLTGKLNAEDFRHLRDEFPSLKVLDISNAEIKMYSGKAGTYPNGKFYIYMANFVPAYAFSNVVNGVTKGKQTLEKVILSEKIKNIEDAAFKGCDNLKICQIRKKTAPNLLPEALADSVTAIFIPLGSSDAYRFKNRWEHFAFIEGEPLETTIQVGAMGKLEDEIMKAGLQPRDINFLTIEGKLDNADFKLIRDYMPNLVSLDISKTNATTIPDFTFAQKKYLLKIKLPHNLKTIGQRVFSNCGRLAGTLELPASVTAIEFGAFMGCDNLRYVLATGDKITTLGDELFGNGVPSKLIYKK 349
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_5-3sb4B01 B:243-347                                                                                  -- Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_5-3sb4B02 B:243-347                                                                                  -- Pfam domains (2)
           Pfam domains (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_5-3sb4B03 B:243-347                                                                                  -- Pfam domains (3)
           Pfam domains (4) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LRR_5-3sb4B04 B:243-347                                                                                  -- Pfam domains (4)
         Sec.struct. author ..eeeeee....hhhhhhhhhhhhhh.eeeeeeeehhhhhhhhhhh.....eeeeeeeee..eee....hhhhh.eee...ee.....eeee..eeee.....eeee.....ee............eeee......ee..........eeee....hhhhhh........eee....eeeeee....hhhhhhhhh..hhhhh.eeeeee..hhhhhhhhhhhh....eee.......ee............eee......ee............eeeee.....ee..........eeeeee......ee............eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3sb4 B  22 QVSKTYYVSKPGTLISmmTEEEANSITHLTLTGKLNAEDFRHLRDEFPSLKVLDISNAEIKmYSGKAGTYPNGKFYIYmANFVPAYAFSNVVNGVTKGKQTLEKVILSEKIKNIEDAAFKGCDNLKICQIRKKTAPNLLPEALADSVTAIFIPLGSSDAYRFKNRWEHFAFIEGEPLETTIQVGAmGKLEDEImKAGLQPRDINFLTIEGKLDNADFKLIRDYmPNLVSLDISKTNATTIPDFTFAQKKYLLKIKLPHNLKTIGQRVFSNCGRLAGTLELPASVTAIEFGAFmGCDNLRYVLATGDKITTLGDELFGNGVPSKLIYKK 349
                                    31      ||41        51        61        71        81 |      91       101       111       121       131       141       151       161       171       181       191       201     | 211   |   221       231       241   |   251       261       271       281       291       301       311  |    321       331       341        
                                           38-MSE                                       83-MSE          100-MSE                                                                                                    207-MSE 215-MSE                       245-MSE                                                              314-MSE                               
                                            39-MSE                                                                                                                                                                                                                                                                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3SB4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3SB4)

(-) Pfam Domains  (1, 4)

Asymmetric Unit
(-)
Clan: LRR (77)
1aLRR_5-3sb4B01B:243-347
1bLRR_5-3sb4B02B:243-347
1cLRR_5-3sb4B03B:243-347
1dLRR_5-3sb4B04B:243-347

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3SB4)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PG4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3sb4)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3sb4
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8A8C7_BACTN | Q8A8C7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8A8C7_BACTN | Q8A8C7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3SB4)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3SB4)