|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3RA0) |
Sites (0, 0)| (no "Site" information available for 3RA0) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3RA0) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3RA0) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3RA0) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3RA0) |
Exons (0, 0)| (no "Exon" information available for 3RA0) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:161 aligned with WHY2_SOLTU | D9J034 from UniProtKB/Swiss-Prot Length:238 Alignment length:161 64 74 84 94 104 114 124 134 144 154 164 174 184 194 204 214 WHY2_SOLTU 55 GRVFAPYSVFKGKAALSAEPRLPTFNRLDSGGVKLNRRGVIMLTFWPSVGERKYDWEKRQLFALSATEVGSLISMGTRDSSEFFHDPSMLSSNAGQVRKSLSIKPNADGSGYFISLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFSFALPHIMGWDRFTNR 215 SCOP domains d3ra0a_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3ra0 A 55 GRVFAPYSVFKGAAALSAEPRLPTFNRLDSGGVKLNRRGVIMLTFWPSVGERKYDWEKRQLFALSATEVGSLISMGTRDSSEFFHDPSMLSSNAGQVRKSLSIKPNADGSGYFISLSVVNNNLKTNDRFTVPVTTAEFAVMRTAFSFALPHIMGWDRFTNR 215 64 74 84 94 104 114 124 134 144 154 164 174 184 194 204 214
Chain B from PDB Type:DNA Length:9
3ra0 B 1 TTTTTTTTT 9
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3RA0) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3RA0) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (WHY2_SOLTU | D9J034)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|