3R3I - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF C-TERMINAL TRUNCATION OF UDP-GLUCOSE PYROPHOSPHORYLASE OF HOMO SAPIENS

Authors :   X. Zheng, Q. Yu

Date :   15 Mar 11 (Deposition) - 21 Mar 12 (Release) - 21 Mar 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.57

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: A  (1x)
Biol. Unit 3: B  (1x)
Biol. Unit 4: C  (1x)
Biol. Unit 5: D  (1x)

Keywords :   Rossmann Fold, Beta Barrel, Nucleotidyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. Zheng, Q. Yu
Crystal Structure Of Udp-Glucose Pyrophosphorylase Of Homo Sapiens
To Be Published
PubMed: search

Molecule 1 - UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
	Chains	:	A, B, C, D
	EC Number	:	2.7.7.9
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	UGP2, UGP1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	UDP-GLUCOSE PYROPHOSPHORYLASE, UDPGP, UGPASE

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:	A
Biological Unit 3 (1x)	:		B
Biological Unit 4 (1x)	:			C
Biological Unit 5 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3R3I)

(no "Site" information available for 3R3I)

(no "SS Bond" information available for 3R3I)

Asymmetric Unit

No.	Residues
1	Gly A:65	-	Lys A:66
2	Arg A:84	-	Gly A:85
3	Asp A:88	-	Asn A:89
4	Ile A:90	-	Ser A:91
5	Ser A:91	-	Ser A:92
6	Ser A:92	-	Val A:93
7	Asn A:123	-	Glu A:124
8	Arg A:264	-	Cys A:265
9	Ser A:309	-	Val A:310
10	Leu A:348	-	Asp A:349
11	Glu A:409	-	Lys A:410
12	Thr B:31	-	Ala B:32
13	Glu B:38	-	His B:39
14	Gly B:65	-	Lys B:66
15	Arg B:84	-	Gly B:85
16	Asn B:89	-	Ile B:90
17	Ile B:90	-	Ser B:91
18	Ser B:91	-	Ser B:92
19	Asn B:123	-	Glu B:124
20	Lys B:263	-	Arg B:264
21	Cys B:265	-	Glu B:266
22	Ser B:309	-	Val B:310
23	Ser B:311	-	Lys B:312
24	Leu B:348	-	Asp B:349
25	Glu B:409	-	Lys B:410
26	Gly C:65	-	Lys C:66
27	Arg C:84	-	Gly C:85
28	Asp C:88	-	Asn C:89
29	Ile C:90	-	Ser C:91
30	Ser C:91	-	Ser C:92
31	Ser C:92	-	Val C:93
32	Asn C:123	-	Glu C:124
33	Cys C:265	-	Glu C:266
34	Ser C:309	-	Val C:310
35	Ser C:311	-	Lys C:312
36	Leu C:348	-	Asp C:349
37	Glu C:409	-	Lys C:410
38	Gly D:65	-	Lys D:66
39	Arg D:84	-	Gly D:85
40	Ile D:90	-	Ser D:91
41	Ser D:91	-	Ser D:92
42	Asn D:123	-	Glu D:124
43	Lys D:263	-	Arg D:264
44	Cys D:265	-	Glu D:266
45	Ser D:309	-	Val D:310
46	Ser D:311	-	Lys D:312
47	Leu D:348	-	Asp D:349
48	Glu D:409	-	Lys D:410

Asymmetric Unit (1, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033042	M	268	I	UGPA_HUMAN	Polymorphism	1130982	A/B/C/D	M	257	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033042	M	268	I	UGPA_HUMAN	Polymorphism	1130982	A/B/C/D	M	257	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033042	M	268	I	UGPA_HUMAN	Polymorphism	1130982	A	M	257	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033042	M	268	I	UGPA_HUMAN	Polymorphism	1130982	B	M	257	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033042	M	268	I	UGPA_HUMAN	Polymorphism	1130982	C	M	257	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_033042	M	268	I	UGPA_HUMAN	Polymorphism	1130982	D	M	257	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3R3I)

(no "Exon" information available for 3R3I)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:457
 aligned with UGPA_HUMAN | Q16851 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:477
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       
           UGPA_HUMAN    24 IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS 500
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........................hhhhhhhhhhhhhhhhhhhhh-------...........eehhhhh..............eeeeee............hhhh.eee..eehhhhhhhhhhhhhhhhh....eeeee...hhhhhhh.hhhhh.....eeeee......ee.......-------------.......hhhhhhhhhhhhhhhhhh...eeeeee........hhhhhhhhh.........eeeee...........eee......eee.....hhhhh............eeeeeeeehhhhhhhhhh.......eeeee.......eeeee...............ee.hhhhh....hhhhhhhhhh...eee..eee...........eeee.....hhhhhhhhh....eeeeeeeeeee.eee.....eeeeeeeee.....eee.....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r3i A  13 IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQE-------GKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPV-------------WYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS 489
                                    22        32        42        52    |    -  |     72        82        92       102       112       122       132       142       152       162       172       182       192|        -    |  212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       
                                                                       57      65                                                                                                                             193           207

Chain B from PDB  Type:PROTEIN  Length:463
 aligned with UGPA_HUMAN | Q16851 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:483
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497   
           UGPA_HUMAN    18 SQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS 500
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhh-------..........eeehhhhhh.........hhh.eeeeeee...........hhhh.eee..eehhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhhhhh....eeeeee................-------------...hhhhhhhhhhhh.hhhhhhh....eeeeee........hhhhhhh...........eeeeeee.........eeeee..eeeee.....hhhhhhhhhh.....eeeeeeeeeehhhhhhhhh.......ee...............ee.hhhhhhh.....eee..........hhhhhhhhhh..eeee..eeee..........eee.hhhhhhhhhhhhhh....eeeeeeeeeee..eee....eeeeeeeee......eee....eee..ee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r3i B   7 SQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQE-------GKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVA-------------YPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS 489
                                    16        26        36        46        56|       66        76        86        96       106       116       126       136       146       156       166       176       186       | -         - |     216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486   
                                                                             57      65                                                                                                                              194           208

Chain C from PDB  Type:PROTEIN  Length:439
 aligned with UGPA_HUMAN | Q16851 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:474
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496    
           UGPA_HUMAN    27 ELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS 500
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......................hhhhhhhhhhhhhh.....-------...........-hhhhhh...............eeee........................hhhhhhhhhhhhhhhhhh....eee.....hhhhhhhhhhhhh.....eee........ee...------------------........-hhhhhhhhhhhhhh....eeeee...........hhhhhhh.------..eeeee...........e--ee..eeeee......hhhhh...........eeeeeeeehhhhh...........ee..ee.......ee..ee.hhhh............hhhhh....hhhhhhhhh...eeee..eeee...........eee.hhhhhhhhhhhhh........eeeeeee.eeee....eeeeeeeee.....eeee....eeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3r3i C  16 ELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQE-------GKIQRPPEDSI-PYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKES------------------YPPGHGDI-ASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMN------CEFVMEVTNKTRADVKGGT--QYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS 489
                                    25        35        45        55 |      65        75 |      85        95       105       115       125       135       145       155       165       175       185   |     -         -  |    215 |     225       235       245       255  |    265       275       | -|      295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485    
                                                                    57      65        75 |                                                                                                             189                208    215 |                                      258    265               283  |                                                                                                                                                                                                           
                                                                                        77                                                                                                                                         217                                                                  286

Chain D from PDB  Type:PROTEIN  Length:460
 aligned with UGPA_HUMAN | Q16851 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:479
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491         
           UGPA_HUMAN    22 EVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS 500
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh-------..........eeehhhhhh.........hhh.eeeeee....hhhhh...hhhhh......hhhhhhhhhhhhhhhhhh....eeeee....hhhhhhhhhhhh.....eeeee...eeeee.....ee------------eee......hhhhhhhhhhhhhhh.....eeeeee........hhhhhhhhh.........eeeeeee.hhhhh...eee......eeehhhhh.hhhhh.........eeeeeeeeeehhhhhhhhhh..........ee.......ee.....hhhhhhhh...eeee.hhhhh....hhhhhhhhh...eeee..eeee..........eee......hhhhhhhhh........eeeeeee..eee....eeeeeeeee......eee....eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r3i D  11 EVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQE-------GKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPV------------AWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVS 489
                                    20        30        40        50      |  -    |   70        80        90       100       110       120       130       140       150       160       170       180       190  |      -     | 210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480         
                                                                         57      65                                                                                                                             193          206

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3R3I)

(no "CATH Domain" information available for 3R3I)

(no "Pfam Domain" information available for 3R3I)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (UGPA_HUMAN | Q16851)

molecular function
	GO:0003983	UTP:glucose-1-phosphate uridylyltransferase activity	Catalysis of the reaction: alpha-D-glucose 1-phosphate + UTP = diphosphate + UDP-D-glucose.
	GO:0005536	glucose binding	Interacting selectively and non-covalently with the D- or L-enantiomer of glucose.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032557	pyrimidine ribonucleotide binding	Interacting selectively and non-covalently with a pyrimidine ribonucleotide, any compound consisting of a pyrimidine ribonucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose moiety.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0070569	uridylyltransferase activity	Catalysis of the transfer of an uridylyl group to an acceptor.
biological process
	GO:0006011	UDP-glucose metabolic process	The chemical reactions and pathways involving UDP-glucose, uridinediphosphoglucose, a substance composed of glucose in glycosidic linkage with uridine diphosphate.
	GO:0006065	UDP-glucuronate biosynthetic process	The chemical reactions and pathways resulting in the formation of UDP-glucuronate, a substance composed of glucuronic acid in glycosidic linkage with uridine diphosphate.
	GO:0019255	glucose 1-phosphate metabolic process	The chemical reactions and pathways involving glucose 1-phosphate, a monophosphorylated derivative of glucose with the phosphate group attached to C-1.
	GO:0005978	glycogen biosynthetic process	The chemical reactions and pathways resulting in the formation of glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3r3i)

	Sites
(no "Sites" information available for 3r3i)

	Cis Peptide Bonds
		Arg A:264 - Cys A:265	[ RasMol ]
		Arg A:84 - Gly A:85	[ RasMol ]
		Arg B:84 - Gly B:85	[ RasMol ]
		Arg C:84 - Gly C:85	[ RasMol ]
		Arg D:84 - Gly D:85	[ RasMol ]
		Asn A:123 - Glu A:124	[ RasMol ]
		Asn B:123 - Glu B:124	[ RasMol ]
		Asn B:89 - Ile B:90	[ RasMol ]
		Asn C:123 - Glu C:124	[ RasMol ]
		Asn D:123 - Glu D:124	[ RasMol ]
		Asp A:88 - Asn A:89	[ RasMol ]
		Asp C:88 - Asn C:89	[ RasMol ]
		Cys B:265 - Glu B:266	[ RasMol ]
		Cys C:265 - Glu C:266	[ RasMol ]
		Cys D:265 - Glu D:266	[ RasMol ]
		Glu A:409 - Lys A:410	[ RasMol ]
		Glu B:38 - His B:39	[ RasMol ]
		Glu B:409 - Lys B:410	[ RasMol ]
		Glu C:409 - Lys C:410	[ RasMol ]
		Glu D:409 - Lys D:410	[ RasMol ]
		Gly A:65 - Lys A:66	[ RasMol ]
		Gly B:65 - Lys B:66	[ RasMol ]
		Gly C:65 - Lys C:66	[ RasMol ]
		Gly D:65 - Lys D:66	[ RasMol ]
		Ile A:90 - Ser A:91	[ RasMol ]
		Ile B:90 - Ser B:91	[ RasMol ]
		Ile C:90 - Ser C:91	[ RasMol ]
		Ile D:90 - Ser D:91	[ RasMol ]
		Leu A:348 - Asp A:349	[ RasMol ]
		Leu B:348 - Asp B:349	[ RasMol ]
		Leu C:348 - Asp C:349	[ RasMol ]
		Leu D:348 - Asp D:349	[ RasMol ]
		Lys B:263 - Arg B:264	[ RasMol ]
		Lys D:263 - Arg D:264	[ RasMol ]
		Ser A:309 - Val A:310	[ RasMol ]
		Ser A:91 - Ser A:92	[ RasMol ]
		Ser A:92 - Val A:93	[ RasMol ]
		Ser B:309 - Val B:310	[ RasMol ]
		Ser B:311 - Lys B:312	[ RasMol ]
		Ser B:91 - Ser B:92	[ RasMol ]
		Ser C:309 - Val C:310	[ RasMol ]
		Ser C:311 - Lys C:312	[ RasMol ]
		Ser C:91 - Ser C:92	[ RasMol ]
		Ser C:92 - Val C:93	[ RasMol ]
		Ser D:309 - Val D:310	[ RasMol ]
		Ser D:311 - Lys D:312	[ RasMol ]
		Ser D:91 - Ser D:92	[ RasMol ]
		Thr B:31 - Ala B:32	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3r3i
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	UGPA_HUMAN \| Q16851
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.7.9
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	UGPA_HUMAN \| Q16851
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	UGPA_HUMAN \| Q16851	:	3r2w 4r7p

(no "Related Entries Specified in the PDB File" available for 3R3I)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (48, 48)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 4)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (18, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File