Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCUTRE OF UDP-GLUCOSE PYROPHOSPHORYLASE OF HOMO SAPIENS
 
Authors :  X. Zheng, Q. Yu
Date :  14 Mar 11  (Deposition) - 08 Feb 12  (Release) - 29 Feb 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.60
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (2x)
Keywords :  Homo Sapiens, Rossmann Fold Beta Barrel, Nucleotidyltransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Q. Yu, X. Zheng
The Crystal Structure Of Human Udp-Glucose Pyrophosphorylas Reveals A Latch Effect That Influences Enzymatic Activity.
Biochem. J. V. 442 283 2012
PubMed-ID: 22132858  |  Reference-DOI: 10.1042/BJ20111598

(-) Compounds

Molecule 1 - UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE
    Chains: A, B, C, D
    EC Number: 2.7.7.9
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: UGP2, UGP1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: UDP-GLUCOSE PYROPHOSPHORYLASE, UDPGP, UGPASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (2x): ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3R2W)

(-) Sites  (0, 0)

(no "Site" information available for 3R2W)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3R2W)

(-) Cis Peptide Bonds  (44, 44)

Asymmetric Unit
No.Residues
1Gly A:65 -Lys A:66
2Arg A:84 -Gly A:85
3Asn A:89 -Ile A:90
4Ile A:90 -Ser A:91
5Ser A:91 -Ser A:92
6Asn A:123 -Glu A:124
7Arg A:264 -Cys A:265
8Ser A:309 -Val A:310
9Leu A:348 -Asp A:349
10Glu A:409 -Lys A:410
11Gly B:65 -Lys B:66
12Arg B:84 -Gly B:85
13Asn B:89 -Ile B:90
14Ile B:90 -Ser B:91
15Asn B:123 -Glu B:124
16Lys B:263 -Arg B:264
17Cys B:265 -Glu B:266
18Ser B:309 -Val B:310
19Ser B:311 -Lys B:312
20Leu B:348 -Asp B:349
21Glu B:409 -Lys B:410
22Gly C:65 -Lys C:66
23Arg C:84 -Gly C:85
24Asp C:88 -Asn C:89
25Ile C:90 -Ser C:91
26Ser C:91 -Ser C:92
27Ser C:92 -Val C:93
28Asn C:123 -Glu C:124
29Ser C:309 -Val C:310
30Ser C:311 -Lys C:312
31Leu C:348 -Asp C:349
32Glu C:409 -Lys C:410
33Gly D:65 -Lys D:66
34Arg D:84 -Gly D:85
35Asn D:89 -Ile D:90
36Ile D:90 -Ser D:91
37Ser D:91 -Ser D:92
38Asn D:123 -Glu D:124
39Lys D:263 -Arg D:264
40Cys D:265 -Glu D:266
41Ser D:309 -Val D:310
42Ser D:311 -Lys D:312
43Leu D:348 -Asp D:349
44Glu D:409 -Lys D:410

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 3)

Asymmetric Unit (1, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_033042M268IUGPA_HUMANPolymorphism1130982A/B/DM257I
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_033042M268IUGPA_HUMANPolymorphism1130982A/B/DM257I
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3R2W)

(-) Exons   (0, 0)

(no "Exon" information available for 3R2W)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:465
 aligned with UGPA_HUMAN | Q16851 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:485
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503     
           UGPA_HUMAN    24 IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhh........hhhhhhhhhhhhhhhhhhh-------...........eehhhhhh.........hhh.eeeeee............hhhh.eee..ee.hhhhhhhhhhhhhhhh....eeeee...hhhhhhhhhhhhh.....eeeee......ee.......-------------.......hhhhhhhhhhhhhhhhh....eeeeee........hhhhhh............eeeeee.........eeeeee..eeeeee....hhhhh...........eeeeeeeeehhhhhhhhhhh......eeeee.......eeeee..hhhhh........ee.hhhhh....hhhhhhhhh...eee....eee..........eeee.....hhhhhhhhh........eeeeeee.eee.....eeeeeeeee.....eee.....eeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r2w A  13 IRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQE-------GKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPV-------------WYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 497
                                    22        32        42        52    |    -  |     72        82        92       102       112       122       132       142       152       162       172       182       192|        -    |  212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492     
                                                                       57      65                                                                                                                             193           207                                                                                                                                                                                                                                                                                                  


Chain B from PDB  Type:PROTEIN  Length:467
 aligned with UGPA_HUMAN | Q16851 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:488
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500        
           UGPA_HUMAN    21 QEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh.--------..........eeehhhhhh.............eeeeee............hhhh.eee..eehhhhhhhhhhhhhhhh.....eeeeehhhhhhhhhhhhhhhh.....eeeee......ee........-------------......hhhhhhhhh.hhhhhhh....eeeeee.........hhhhhh...........eeeeeee.........eeeee..eeeee.....hhhhhhhhhh.....eeeeeeeeeehhhhhhhhh.......ee..ee.......ee..ee.hhhhhhhh....eee.hhhhh....hhhhhhhh.....eee..eee...........eeee.hhhhhhhhhhhhh....eeeeeeeeeee.eeee....eeeeeeeee.....eeee....eeeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r2w B  10 QEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQ--------GKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVA-------------YPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 497
                                    19        29        39        49      |  -     |  69        79        89        99       109       119       129       139       149       159       169       179       189    |    -       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489        
                                                                         56       65                                                                                                                              194           208                                                                                                                                                                                                                                                                                                 


Chain C from PDB  Type:PROTEIN  Length:450
 aligned with UGPA_HUMAN | Q16851 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:483
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505   
           UGPA_HUMAN    26 QELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh............hhhhhhhhhhhhhh.....-------................................eeeeee............................hhhhhhhhhh.......eeee.hhhhhhhhh.hhhhh......eee.............------------------.......hhhhhhhhhhhhhhhhhh..eeeee.................--------..eeeee...........eee......eee.....hhhhh............eeeeeeeehhhhhhhh........ee..ee.......ee..ee..............ee.hhhhh....hhhhhhhhh...eee....eee...........eee.hhhhhhhhhhhhh........eeeeeee.eee.....eeeeeeeee.....eee.....eeeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r2w C  15 QELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQE-------GKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKES------------------YPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHL--------CEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 497
                                    24        34        44        54  |      -|       74        84        94       104       114       124       134       144       154       164       174       184    |    -         -   |   214       224       234       244       254 |       -|      274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494   
                                                                     57      65                                                                                                                         189                208                                             256      265                                                                                                                                                                                                                                        


Chain D from PDB  Type:PROTEIN  Length:468
 aligned with UGPA_HUMAN | Q16851 from UniProtKB/Swiss-Prot  Length:508

    Alignment length:487
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       
           UGPA_HUMAN    22 EVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh-------..........eeehhhhhh.............eeeeee............hhhh.eee..eehhhhhhhhhhhhhhh.....eeeeee....hhhhhhhhhhhh....eeeeee...ee.ee.......------------.ee......hhhhhhh.hhhhhhhh....eeeeee........hhhhhh............eeeeeee.........eeeee..eeeeehhhhh..hhhhh........eeeeeeeeeehhhhhhhhh.......eeee.........eeeeee.hhhhhhhh....eee.hhhhh....hhhhhhhhh...eeee..eeee..........eeee.....hhhhhhhhh........eeeeeee..eee....eeeeeeeee......eee....eee..eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3r2w D  11 EVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQE-------GKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPV------------AWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 497
                                    20        30        40        50      |  -    |   70        80        90       100       110       120       130       140       150       160       170       180       190  |      -     | 210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       
                                                                         57      65                                                                                                                             193          206
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3R2W)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3R2W)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3R2W)

(-) Gene Ontology  (18, 18)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (UGPA_HUMAN | Q16851)
molecular function
    GO:0003983    UTP:glucose-1-phosphate uridylyltransferase activity    Catalysis of the reaction: alpha-D-glucose 1-phosphate + UTP = diphosphate + UDP-D-glucose.
    GO:0005536    glucose binding    Interacting selectively and non-covalently with the D- or L-enantiomer of glucose.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0032557    pyrimidine ribonucleotide binding    Interacting selectively and non-covalently with a pyrimidine ribonucleotide, any compound consisting of a pyrimidine ribonucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose moiety.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0070569    uridylyltransferase activity    Catalysis of the transfer of an uridylyl group to an acceptor.
biological process
    GO:0006011    UDP-glucose metabolic process    The chemical reactions and pathways involving UDP-glucose, uridinediphosphoglucose, a substance composed of glucose in glycosidic linkage with uridine diphosphate.
    GO:0006065    UDP-glucuronate biosynthetic process    The chemical reactions and pathways resulting in the formation of UDP-glucuronate, a substance composed of glucuronic acid in glycosidic linkage with uridine diphosphate.
    GO:0019255    glucose 1-phosphate metabolic process    The chemical reactions and pathways involving glucose 1-phosphate, a monophosphorylated derivative of glucose with the phosphate group attached to C-1.
    GO:0005978    glycogen biosynthetic process    The chemical reactions and pathways resulting in the formation of glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3r2w)
 
  Sites
(no "Sites" information available for 3r2w)
 
  Cis Peptide Bonds
    Arg A:264 - Cys A:265   [ RasMol ]  
    Arg A:84 - Gly A:85   [ RasMol ]  
    Arg B:84 - Gly B:85   [ RasMol ]  
    Arg C:84 - Gly C:85   [ RasMol ]  
    Arg D:84 - Gly D:85   [ RasMol ]  
    Asn A:123 - Glu A:124   [ RasMol ]  
    Asn A:89 - Ile A:90   [ RasMol ]  
    Asn B:123 - Glu B:124   [ RasMol ]  
    Asn B:89 - Ile B:90   [ RasMol ]  
    Asn C:123 - Glu C:124   [ RasMol ]  
    Asn D:123 - Glu D:124   [ RasMol ]  
    Asn D:89 - Ile D:90   [ RasMol ]  
    Asp C:88 - Asn C:89   [ RasMol ]  
    Cys B:265 - Glu B:266   [ RasMol ]  
    Cys D:265 - Glu D:266   [ RasMol ]  
    Glu A:409 - Lys A:410   [ RasMol ]  
    Glu B:409 - Lys B:410   [ RasMol ]  
    Glu C:409 - Lys C:410   [ RasMol ]  
    Glu D:409 - Lys D:410   [ RasMol ]  
    Gly A:65 - Lys A:66   [ RasMol ]  
    Gly B:65 - Lys B:66   [ RasMol ]  
    Gly C:65 - Lys C:66   [ RasMol ]  
    Gly D:65 - Lys D:66   [ RasMol ]  
    Ile A:90 - Ser A:91   [ RasMol ]  
    Ile B:90 - Ser B:91   [ RasMol ]  
    Ile C:90 - Ser C:91   [ RasMol ]  
    Ile D:90 - Ser D:91   [ RasMol ]  
    Leu A:348 - Asp A:349   [ RasMol ]  
    Leu B:348 - Asp B:349   [ RasMol ]  
    Leu C:348 - Asp C:349   [ RasMol ]  
    Leu D:348 - Asp D:349   [ RasMol ]  
    Lys B:263 - Arg B:264   [ RasMol ]  
    Lys D:263 - Arg D:264   [ RasMol ]  
    Ser A:309 - Val A:310   [ RasMol ]  
    Ser A:91 - Ser A:92   [ RasMol ]  
    Ser B:309 - Val B:310   [ RasMol ]  
    Ser B:311 - Lys B:312   [ RasMol ]  
    Ser C:309 - Val C:310   [ RasMol ]  
    Ser C:311 - Lys C:312   [ RasMol ]  
    Ser C:91 - Ser C:92   [ RasMol ]  
    Ser C:92 - Val C:93   [ RasMol ]  
    Ser D:309 - Val D:310   [ RasMol ]  
    Ser D:311 - Lys D:312   [ RasMol ]  
    Ser D:91 - Ser D:92   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3r2w
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UGPA_HUMAN | Q16851
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.9
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  UGPA_HUMAN | Q16851
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        UGPA_HUMAN | Q16851: 3r3i 4r7p

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3R2W)