Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE ANALYSIS OF ENTAMOEBA HISTOLYTICA METHYLTRANSFERASE EHMETH
 
Authors :  E. C. Schulz, H. M. Roth, S. Ankri, R. Ficner
Date :  25 Feb 11  (Deposition) - 11 Apr 12  (Release) - 11 Apr 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym./Biol. Unit :  A
Keywords :  Methyltransferase, Dnmt2, Ehmeth, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. C. Schulz, H. M. Roth, S. Ankri, R. Ficner
Crystal Structure Analysis Of Entamoeba Histolytica Methyltransferase
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - 5-CYTOSINE DNA METHYLTRANSFERASE
    ChainsA
    EC Number2.1.1.37
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX-6P3
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneMETH, EHI_069140
    Organism ScientificENTAMOEBA HISTOLYTICA
    Organism Taxid5759
    SynonymDNA (CYTOSINE-5)-METHYLTRANSFERASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
2SO43Ligand/IonSULFATE ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:12 , SER A:13 , GLY A:14 , ILE A:15 , GLY A:17 , ASP A:37 , ILE A:38 , ASN A:39 , ASN A:58 , LEU A:59 , ASP A:60 , SER A:78 , PRO A:80 , HOH A:396 , HOH A:440BINDING SITE FOR RESIDUE SAH A 323
2AC2SOFTWARELYS A:57 , GLN A:146 , HOH A:373 , HOH A:375 , HOH A:491BINDING SITE FOR RESIDUE SO4 A 324
3AC3SOFTWARELYS A:4 , ASN A:73 , LYS A:119 , HOH A:433 , HOH A:468BINDING SITE FOR RESIDUE SO4 A 325
4AC4SOFTWAREASN A:272 , LYS A:276 , HOH A:407BINDING SITE FOR RESIDUE SO4 A 326

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3QV2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3QV2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3QV2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3QV2)

(-) Exons   (0, 0)

(no "Exon" information available for 3QV2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:320
 aligned with Q6Q386_ENTHI | Q6Q386 from UniProtKB/TrEMBL  Length:322

    Alignment length:320
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322
         Q6Q386_ENTHI     3 QKQVNVIEFFSGIGGLRSSYERSSININATFIPFDINEIANKIYSKNFKEEVQVKNLDSISIKQIESLNCNTWFMSPPCQPYNNSIMSKHKDINDPRAKSVLHLYRDILPYLINKPKHIFIENVPLFKESLVFKEIYNILIKNQYYIKDIICSPIDIGIPNSRTRYYVMARLTPFKNEIQLHQEKESMISNYLDNNVNESYSIPSDLILKKGMLFDIVGKDDKRTCCFTKSYTKIVEGTGSIYCPIEPHFIPVKKAEDLLNKNLRYFTPNEIKKIHGFSSNFTTQIDGLTDKQQYQCLGNSVSCFVIAQLMEYLFDDLKE 322
               SCOP domains d3qv2a_ A: automated matches                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee....hhhhhhhhhh.....eeeeee..hhhhhhhhhhhhh...........hhhhhhhh...eeee.......hhhhhh......hhhhhhhhhhhhhhhhhh.....eeeeeehhhhhhhhhhhhhhhhhhhh..eeeeeeehhhhhh......eeeeeee................hhhhhh....hhhhh.hhhhhhhhhhhh.eee......................eee..........hhhhhh.......hhhhhhhhh.............hhhhhhhhhhh..hhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qv2 A   3 QKQVNVIEFFSGIGGLRSSYERSSININATFIPFDINEIANKIYSKNFKEEVQVKNLDSISIKQIESLNCNTWFMSPPCQPYNNSIMSKHKDINDPRAKSVLHLYRDILPYLINKPKHIFIENVPLFKESLVFKEIYNILIKNQYYIKDIICSPIDIGIPNSRTRYYVMARLTPFKNEIQLHQEKESMISNYLDNNVNESYSIPSDLILKKGMLFDIVGKDDKRTCCFTKSYTKIVEGTGSIYCPIEPHFIPVKKAEDLLNKNLRYFTPNEIKKIHGFSSNFTTQIDGLTDKQQYQCLGNSVSCFVIAQLMEYLFDDLKE 322
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3QV2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3QV2)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q6Q386_ENTHI | Q6Q386)
molecular function
    GO:0003886    DNA (cytosine-5-)-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine + DNA containing cytosine = S-adenosyl-L-homocysteine + DNA containing 5-methylcytosine.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0090116    C-5 methylation of cytosine    The covalent transfer of a methyl group to C-5 of cytosine in a DNA molecule.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SAH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3qv2)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3qv2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6Q386_ENTHI | Q6Q386
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.37
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q6Q386_ENTHI | Q6Q386
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3QV2)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3QV2)