Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF KNI-10006 COMPLEX OF PLASMEPSIN I (PMI) FROM PLASMODIUM FALCIPARUM
 
Authors :  P. Bhaumik, A. Gustchina, A. Wlodawer
Date :  19 Feb 11  (Deposition) - 11 May 11  (Release) - 22 Jun 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.10
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Aspartic Protease, Malaria, Kni, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  P. Bhaumik, Y. Horimoto, H. Xiao, T. Miura, K. Hidaka, Y. Kiso, A. Wlodawer, R. Y. Yada, A. Gustchina
Crystal Structures Of The Free And Inhibited Forms Of Plasmepsin I (Pmi) From Plasmodium Falciparum.
J. Struct. Biol. V. 175 73 2011
PubMed-ID: 21521654  |  Reference-DOI: 10.1016/J.JSB.2011.04.009

(-) Compounds

Molecule 1 - PLASMEPSIN-1
    ChainsA, B, C, D
    EC Number3.4.23.38
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET32B(+)
    Expression System StrainROSETTA-GAMI B (DE3) PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentUNP RESIDUES 117-452
    GenePMI
    Organism ScientificPLASMODIUM FALCIPARUM
    Organism Taxid5833
    SynonymASPARTIC HEMOGLOBINASE I, PFAPG

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 14)

Asymmetric/Biological Unit (2, 14)
No.NameCountTypeFull Name
10064Ligand/Ion(4R)-3-[(2S,3S)-3-{[(2,6-DIMETHYLPHENOXY)ACETYL]AMINO}-2-HYDROXY-4-PHENYLBUTANOYL]-N-[(1S,2R)-2-HYDROXY-2,3-DIHYDRO-1H-INDEN-1-YL]-5,5-DIMETHYL-1,3-THIAZOLIDINE-4-CARBOXAMIDE
2GOL10Ligand/IonGLYCEROL

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:32 , GLY A:34 , SER A:35 , TYR A:75 , VAL A:76 , SER A:77 , TYR A:189 , ASP A:215 , GLY A:217 , THR A:218 , SER A:219 , THR A:222 , ILE A:287 , LEU A:291BINDING SITE FOR RESIDUE 006 A 330
02AC2SOFTWAREPHE A:242 , ASP B:32 , GLY B:34 , ASN B:74 , TYR B:75 , VAL B:76 , SER B:77 , LEU B:128 , TYR B:189 , ASP B:215 , GLY B:217 , THR B:218 , SER B:219 , ILE B:287 , ILE B:300BINDING SITE FOR RESIDUE 006 B 330
03AC3SOFTWAREASP C:32 , GLY C:34 , SER C:35 , TYR C:75 , VAL C:76 , SER C:77 , ILE C:130 , TYR C:189 , ASP C:215 , GLY C:217 , THR C:218 , SER C:219 , ILE C:287 , LEU C:291 , PHE D:242BINDING SITE FOR RESIDUE 006 C 330
04AC4SOFTWAREPHE C:242 , ILE D:30 , ASP D:32 , GLY D:34 , SER D:35 , TYR D:75 , VAL D:76 , SER D:77 , ILE D:130 , TYR D:189 , ASP D:215 , GLY D:217 , THR D:218 , SER D:219 , ILE D:287 , ILE D:300 , GOL D:332BINDING SITE FOR RESIDUE 006 D 330
05AC5SOFTWARETYR B:189 , LEU B:291 , ASN B:292BINDING SITE FOR RESIDUE GOL B 331
06AC6SOFTWAREPRO C:110 , ALA C:111 , LEU C:114 , GLY C:115 , LYS D:239 , PHE D:242BINDING SITE FOR RESIDUE GOL C 331
07AC7SOFTWARELEU A:291 , ASN A:292 , THR A:298BINDING SITE FOR RESIDUE GOL A 331
08AC8SOFTWARESER A:219 , SER A:220 , SER A:285BINDING SITE FOR RESIDUE GOL A 332
09AC9SOFTWAREASP D:193 , LEU D:194 , ASP D:195 , ARG D:261 , SER D:262 , ALA D:263BINDING SITE FOR RESIDUE GOL D 331
10BC1SOFTWAREPRO C:243ABINDING SITE FOR RESIDUE GOL C 332
11BC2SOFTWAREVAL A:76BINDING SITE FOR RESIDUE GOL A 333
12BC3SOFTWAREVAL D:76 , VAL D:289 , 006 D:330BINDING SITE FOR RESIDUE GOL D 332
13BC4SOFTWARETYR C:189 , GLN C:191 , LEU C:291 , ASN C:292BINDING SITE FOR RESIDUE GOL C 333
14BC5SOFTWAREASN B:297BINDING SITE FOR RESIDUE GOL B 332

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1A:45 -A:50
2A:249 -A:282
3B:45 -B:50
4B:249 -B:282
5C:45 -C:50
6C:249 -C:282
7D:45 -D:50
8D:249 -D:282

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Glu A:109B-Pro A:110
2Glu B:109B-Pro B:110
3Glu C:109B-Pro C:110
4Glu D:109B-Pro D:110

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3QS1)

(-) PROSITE Motifs  (2, 12)

Asymmetric/Biological Unit (2, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PEPTIDASE_A1PS51767 Peptidase family A1 domain profile.PLM1_PLAFA139-446
 
 
 
  4A:14-323
B:14-323
C:14-323
D:14-323
2ASP_PROTEASEPS00141 Eukaryotic and viral aspartyl proteases active site.PLM1_PLAFA154-165
 
 
 
334-345
 
 
 
  8A:29-40
B:29-40
C:29-40
D:29-40
A:212-223
B:212-223
C:212-223
D:212-223

(-) Exons   (0, 0)

(no "Exon" information available for 3QS1)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:327
 aligned with PLM1_PLAFA | P39898 from UniProtKB/Swiss-Prot  Length:452

    Alignment length:327
                                   134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       
          PLM1_PLAFA    125 AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKK  451
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee...eeeeeeee....eeeeeeee......eee.....hhhhh.............eeeeeeeeee....eeeeeeeeeeeee..eeeeeeeeeeee..............eeee..hhhhh.....hhhhhhhh.......eeeee........eeeee...hhh.eeeeeeeee.......eeeeeeee..eeeeeeeeee......eeehhhhhhhhhh....ee......eeee........eeee....eeeehhhh.eeeeee...eeeee.eee......eeeehhhhhhheeeeee....eeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------PEPTIDASE_A1  PDB: A:14-323 UniProt: 139-446                                                                                                                                                                                                                                                                        ----- PROSITE (1)
                PROSITE (2) -----------------------------ASP_PROTEASE------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3qs1 A    0 AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKK  328
                                     9        19        29        39        49        59        69        79        89      |100      109A|      118       128       138       148       158       168       178       188      |199|||    212       222       232       242 |     251|      262       272      279B|      288   ||  301       311       321       
                                                                                                                           96|        109A|                                                                                   195| ||||                                   243A     251|                      278A |||          292|                                
                                                                                                                            98         109B                                                                                    197 ||||                                             253                        279A||           296                                
                                                                                                                                                                                                                                 199|||                                                                         279B|                                              
                                                                                                                                                                                                                                  201||                                                                          279C                                              
                                                                                                                                                                                                                                   203|                                                                                                                            
                                                                                                                                                                                                                                    205                                                                                                                            

Chain B from PDB  Type:PROTEIN  Length:327
 aligned with PLM1_PLAFA | P39898 from UniProtKB/Swiss-Prot  Length:452

    Alignment length:327
                                   134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       
          PLM1_PLAFA    125 AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKK  451
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeee...eeeeeeee....eeeeeeee......eee.....hhhhhhh...........eeeeeeeeeee..eeeeeeeeeeeeee..eeeeeeeeeeee..............eeee..hhhhh.....hhhhhhhhh......eeeee........eeeee...hhh.eeeeeeeee.......eeeeeeee..eeeeeeeeee......eeehhhhhhhhhh....ee......eeee........eeee....eeee.....eeeeee...eeeee.eee......eeeehhhhhhheeeeee....eeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --------------PEPTIDASE_A1  PDB: B:14-323 UniProt: 139-446                                                                                                                                                                                                                                                                        ----- PROSITE (1)
                PROSITE (2) -----------------------------ASP_PROTEASE------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3qs1 B    0 AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKK  328
                                     9        19        29        39        49        59        69        79        89      |100      109A|      118       128       138       148       158       168       178       188      |199|||    212       222       232       242 |     251|      262       272      279B|      288   ||  301       311       321       
                                                                                                                           96|        109A|                                                                                   195| ||||                                   243A     251|                      278A |||          292|                                
                                                                                                                            98         109B                                                                                    197 ||||                                             253                        279A||           296                                
                                                                                                                                                                                                                                 199|||                                                                         279B|                                              
                                                                                                                                                                                                                                  201||                                                                          279C                                              
                                                                                                                                                                                                                                   203|                                                                                                                            
                                                                                                                                                                                                                                    205                                                                                                                            

Chain C from PDB  Type:PROTEIN  Length:326
 aligned with PLM1_PLAFA | P39898 from UniProtKB/Swiss-Prot  Length:452

    Alignment length:326
                                   135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445      
          PLM1_PLAFA    126 GDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKK  451
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...eeeeeeee....eeeeeeee......eee.....hhhhh..................eeee......eeeeeeeeeee....eeeeeeeeeeehhhhhhhhhhh...eeee..hhhhh.....hhhhhhhh.......eeeee........eeeee.......eeeeeeeee.......eeeeeeee...eeeeeeeee......eeehhhhhhhhhh....ee......eeee........eeee....eeeehhhhheeeeee...eeeee.eee......eeeehhhhhhheeeeee....eeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------PEPTIDASE_A1  PDB: C:14-323 UniProt: 139-446                                                                                                                                                                                                                                                                        ----- PROSITE (1)
                PROSITE (2) ----------------------------ASP_PROTEASE------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3qs1 C    1 GDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKK  328
                                    10        20        30        40        50        60        70        80        90     ||101      109B       119       129       139       149       159       169       179       189     ||201||     213       223       233       243|      253       263       273     |279C       289  ||   302       312       322      
                                                                                                                          96|        109A|                                                                                   195| ||||                                   243A     251|                      278A |||          292|                                
                                                                                                                           98         109B                                                                                    197 ||||                                             253                        279A||           296                                
                                                                                                                                                                                                                                199|||                                                                         279B|                                              
                                                                                                                                                                                                                                 201||                                                                          279C                                              
                                                                                                                                                                                                                                  203|                                                                                                                            
                                                                                                                                                                                                                                   205                                                                                                                            

Chain D from PDB  Type:PROTEIN  Length:326
 aligned with PLM1_PLAFA | P39898 from UniProtKB/Swiss-Prot  Length:452

    Alignment length:326
                                   135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445      
          PLM1_PLAFA    126 GDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKK  451
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ------------Asp-3qs1D01 D:13-325                                                                                                                                                                                                                                                                                                   --- Pfam domains (1)
           Pfam domains (2) ------------Asp-3qs1D02 D:13-325                                                                                                                                                                                                                                                                                                   --- Pfam domains (2)
           Pfam domains (3) ------------Asp-3qs1D03 D:13-325                                                                                                                                                                                                                                                                                                   --- Pfam domains (3)
           Pfam domains (4) ------------Asp-3qs1D04 D:13-325                                                                                                                                                                                                                                                                                                   --- Pfam domains (4)
         Sec.struct. author ..eeeeeee...eeeeeeee....eeeeeeee......eee.....hhhhh..................eeeeee..eeeeeeeeeeeee....eeeeeeeeeeehhhhhhhhhhh...eeee..hhhhh.....hhhhhhhh.......eeeee.......eeeeee.......eeeeeeeee......eeeeeeeee...eeeeeeeee......eeehhhhhhhhhh....ee......eeee........eeee....eeeehhhh.eeeeee...eeeee.eee......eeeehhhhhhheeeeee....eeeeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------PEPTIDASE_A1  PDB: D:14-323 UniProt: 139-446                                                                                                                                                                                                                                                                        ----- PROSITE (1)
                PROSITE (2) ----------------------------ASP_PROTEASE------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASP_PROTEASE---------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3qs1 D    1 GDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPTLEFRSATNVYTLEPEYYLQQIFDFGISLCMVSIIPVDLNKNTFILGDPFMRKYFTVFDYDNHTVGFALAKKK  328
                                    10        20        30        40        50        60        70        80        90     ||101      109B       119       129       139       149       159       169       179       189     ||201||     213       223       233       243|      253       263       273     |279C       289  ||   302       312       322      
                                                                                                                          96|        109A|                                                                                   195| ||||                                   243A     251|                      278A |||          292|                                
                                                                                                                           98         109B                                                                                    197 ||||                                             253                        279A||           296                                
                                                                                                                                                                                                                                199|||                                                                         279B|                                              
                                                                                                                                                                                                                                 201||                                                                          279C                                              
                                                                                                                                                                                                                                  203|                                                                                                                            
                                                                                                                                                                                                                                   205                                                                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3QS1)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3QS1)

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Family: Asp (155)
1aAsp-3qs1D01D:13-325
1bAsp-3qs1D02D:13-325
1cAsp-3qs1D03D:13-325
1dAsp-3qs1D04D:13-325

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (PLM1_PLAFA | P39898)
molecular function
    GO:0004190    aspartic-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which a water molecule bound by the side chains of aspartic residues at the active center acts as a nucleophile.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
    GO:0005773    vacuole    A closed structure, found only in eukaryotic cells, that is completely surrounded by unit membrane and contains liquid material. Cells contain one or several vacuoles, that may have different functions from each other. Vacuoles have a diverse array of functions. They can act as a storage organelle for nutrients or waste products, as a degradative compartment, as a cost-effective way of increasing cell size, and as a homeostatic regulator controlling both turgor pressure and pH of the cytosol.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    006  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:109B - Pro A:110   [ RasMol ]  
    Glu B:109B - Pro B:110   [ RasMol ]  
    Glu C:109B - Pro C:110   [ RasMol ]  
    Glu D:109B - Pro D:110   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3qs1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PLM1_PLAFA | P39898
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.23.38
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PLM1_PLAFA | P39898
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PLM1_PLAFA | P398981lcr 1ldu 3qrv

(-) Related Entries Specified in the PDB File

3qrv