Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHOSPHOSERINE AMINOTRANSFERASE FROM YERSINIA PESTIS CO92
 
Authors :  B. Nocek, N. Maltseva, L. Papazisi, W. Anderson, A. Joachimiak, Center Structural Genomics Of Infectious Diseases (Csgid)
Date :  13 Jan 11  (Deposition) - 09 Feb 11  (Release) - 09 Feb 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.36
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Serc, 3-Phosphoserine Aminotransferase, Psat, Plp Binding, Csgid, Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Biosynthesis Of The Coenzyme Pyridoxal 5'-Phosphate, Phosphorylated Pathway Of Serine Biosynthesis, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Nocek, N. Maltseva, L. Papazisi, W. Anderson, A. Joachimiak
Crystal Structure Of Phosphoserine Aminotransferase From Yersinia Pestis Co92
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PHOSPHOSERINE AMINOTRANSFERASE
    Chains: A, B
    EC Number: 2.6.1.52
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: YERSINIA PESTIS CO92
    Organism Taxid: 214092

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1PLP2Ligand/IonPYRIDOXAL-5'-PHOSPHATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:75 , ALA A:76 , ARG A:77 , TRP A:102 , CYS A:149 , ASN A:151 , THR A:153 , ASP A:173 , SER A:175 , GLN A:196 , LYS A:197 , HOH A:444 , ASN B:238 , THR B:239 , HOH B:372BINDING SITE FOR RESIDUE PLP A 501
2AC2SOFTWAREASN A:238 , THR A:239 , GLY B:75 , ALA B:76 , ARG B:77 , TRP B:102 , ASN B:151 , THR B:153 , ASP B:173 , SER B:175 , SER B:176 , GLN B:196 , LYS B:197 , HOH B:458 , HOH B:463BINDING SITE FOR RESIDUE PLP B 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3QBO)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Gly A:10 -Pro A:11
2Gly B:10 -Pro B:11

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3QBO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3QBO)

(-) Exons   (0, 0)

(no "Exon" information available for 3QBO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:358
                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains d3qboa_ A: automated matches                                                                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee........hhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhh......eeee.hhhhhhhhhhhh.....eeee.eeee..eeee.hhhhh........eee..ee....ee...........eeee..........hhhhh.eeeee..........eeeeee.hhh.......hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh..ee...hhhhh...eeeeee.hhhhhhhhhhhhhhh.ee..........eeee.....hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qbo A   3 QVYNFSAGPAMLPVEVLRRAQQELRDWHGLGTSVMEVSHRSKEFMQVAEESEKDLRDLLNVPANYKVLFCHGGARAQFAAVPLNLLGDRNSADYVDGGYWAHSAIKEAQKYCTPNVIDVTTHDNGLTGIQPMKQWKLSDNAAYVHYCPNETIDGIAIDEQPDFGNKVVVADFSSSILSRPIDVSRYGVIYAGAQKNIGPAGLTLVIVREDLLGKAHTALPSILDYKILADNDSMFNTPPTFAWYLSGLVFKWLKEQGGLGEMEKRNQAKAELLYGAIDRTGFYRNDVAITNRSWMNVPFQMADASLDKLFLSEAEAQGLQALKGHRVAGGMRASIYNAMPIEGVKALTDFMADFERRH 360
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352        


Chain B from PDB  Type:PROTEIN  Length:359
                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains d3qbob_ B: automated matches                                                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee........hhhhhhhhhhhh.hhhhh..hhhhh...hhhhhhhhhhhhhhhhhhhh....eeeeee..hhhhhhhhhhhhhh......eeee.hhhhhhhhhhhh.....eeee.eee....eee.hhhhh........eee..ee....ee...........eeee..........hhhhh.eeeee..........eeeeee.hhh.......hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee...hhhhh...eeeeee.hhhhhhhhhhhhhhh.ee..eee...eeeeee.....hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3qbo B   3 QVYNFSAGPAMLPVEVLRRAQQELRDWHGLGTSVMEVSHRSKEFMQVAEESEKDLRDLLNVPANYKVLFCHGGARAQFAAVPLNLLGDRNSADYVDGGYWAHSAIKEAQKYCTPNVIDVTTHDNGLTGIQPMKQWKLSDNAAYVHYCPNETIDGIAIDEQPDFGNKVVVADFSSSILSRPIDVSRYGVIYAGAQKNIGPAGLTLVIVREDLLGKAHTALPSILDYKILADNDSMFNTPPTFAWYLSGLVFKWLKEQGGLGEMEKRNQAKAELLYGAIDRTGFYRNDVAITNRSWMNVPFQMADASLDKLFLSEAEAQGLQALKGHRVAGGMRASIYNAMPIEGVKALTDFMADFERRHG 361
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3QBO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3QBO)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3QBO)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:10 - Pro A:11   [ RasMol ]  
    Gly B:10 - Pro B:11   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3qbo
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProt
 
Access by Enzyme Classificator   (EC Number)
  2.6.1.52
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  (no 'UniProt ID/Accession number' available) |
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3QBO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3QBO)