Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF RAD G-DOMAIN Q148A-GTP ANALOG COMPLEX
 
Authors :  Y. Sasson, L. Navon-Perry, J. A. Hirsch
Date :  05 Jan 11  (Deposition) - 21 Sep 11  (Release) - 26 Oct 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  G-Domain, G-Protein, Cav2 Beta, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Sasson, L. Navon-Perry, D. Huppert, J. A. Hirsch
Rgk Family G-Domain:Gtp Analog Complex Structures And Nucleotide-Binding Properties.
J. Mol. Biol. V. 413 372 2011
PubMed-ID: 21903096  |  Reference-DOI: 10.1016/J.JMB.2011.08.017

(-) Compounds

Molecule 1 - GTP-BINDING PROTEIN RAD
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21D
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentG-DOMAIN, RESIDUES 90-255
    GeneRRAD, RAD
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymRAD1, RAS ASSOCIATED WITH DIABETES

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric Unit (3, 5)
No.NameCountTypeFull Name
1CA1Ligand/IonCALCIUM ION
2GNP2Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
3MG2Ligand/IonMAGNESIUM ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2GNP1Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
3MG-1Ligand/IonMAGNESIUM ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2GNP1Ligand/IonPHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
3MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHOH A:6 , HOH A:8 , PRO A:100 , GLY A:101 , VAL A:102 , GLY A:103 , LYS A:104 , SER A:105 , ALA A:106 , ASN A:203 , LYS A:204 , ASP A:206 , LEU A:207 , ALA A:234 , ALA A:235 , MG A:256BINDING SITE FOR RESIDUE GNP A 1
2AC2SOFTWAREGNP A:1 , HOH A:12 , SER A:105 , GLU A:147BINDING SITE FOR RESIDUE MG A 256
3AC3SOFTWAREGLY A:113 , GLU A:115 , GLY A:117 , ASP A:128BINDING SITE FOR RESIDUE CA A 257
4AC4SOFTWAREHOH B:26 , PRO B:100 , GLY B:101 , VAL B:102 , GLY B:103 , LYS B:104 , SER B:105 , ALA B:106 , GLU B:136 , GLU B:147 , ASN B:203 , LYS B:204 , ASP B:206 , LEU B:207 , SER B:233 , ALA B:234 , ALA B:235 , MG B:256BINDING SITE FOR RESIDUE GNP B 1
5AC5SOFTWAREGNP B:1 , HOH B:14 , HOH B:26 , SER B:105 , ASP B:144 , GLU B:147BINDING SITE FOR RESIDUE MG B 256

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3Q7Q)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:112 -Gly A:113
2Gln A:192 -Thr A:193

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3Q7Q)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3Q7Q)

(-) Exons   (4, 8)

Asymmetric Unit (4, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002997591aENSE00001943321chr16:66959547-66959312236RAD_HUMAN-00--
1.2bENST000002997592bENSE00001104552chr16:66959097-66958713385RAD_HUMAN1-1241242A:90-117
B:90-124 (gaps)
28
35
1.3ENST000002997593ENSE00001104559chr16:66957822-6695774974RAD_HUMAN124-148252A:125-147
B:124-147
23
24
1.4ENST000002997594ENSE00001104564chr16:66957623-66957419205RAD_HUMAN149-217692A:161-217
B:161-217 (gaps)
57
57
1.5aENST000002997595aENSE00001931509chr16:66956256-66955588669RAD_HUMAN217-308922A:217-255
B:217-255
39
39

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:146
 aligned with RAD_HUMAN | P55042 from UniProtKB/Swiss-Prot  Length:308

    Alignment length:166
                                    99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249      
            RAD_HUMAN    90 SVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR 255
               SCOP domains d3q7qa_ A: automated matches                                                                                                                                           SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....hhhhhhhhhh.....-------.eeeeeeee..eeeeeeee....-------------...eeeeeee..hhhhhhhhhhhhhhhhh........eeeeee..........hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2b  PDB: A:90-117           ------------------------Exon 1.4  PDB: A:161-217 UniProt: 149-217 [INCOMPLETE]               -------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.3  PDB: A:125-147 --------------------------------------------------------------------Exon 1.5a  PDB: A:217-255 [INCOMPLETE]  Transcript 1 (2)
                 3q7q A  90 SVYKVLLLGAPGVGKSALARIFGGVEDG-------HTYDRSIVVDGEEASLMVYDIWE-------------MGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR 255
                                    99       109       | -     | 129       139       | -         - |     169       179       189       199       209       219       229       239       249      
                                                     117     125                   147           161                                                                                              

Chain B from PDB  Type:PROTEIN  Length:140
 aligned with RAD_HUMAN | P55042 from UniProtKB/Swiss-Prot  Length:308

    Alignment length:166
                                    99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249      
            RAD_HUMAN    90 SVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR 255
               SCOP domains d3q7qb_ B: automated matc         hes                                                                                                                                  SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....hhhhhhhhhhh.---------..eeeeeeee..eeeeeeee....-------------...eeeeeee..hhhhhhhhhhhhhhhhh.----...eeeeee..........hhhhhhhhhhhh..eeee.......hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.2b  PDB: B:90-124 (gaps)    ------------------------Exon 1.4  PDB: B:161-217 (gaps) UniProt: 149-217 [INCOMPLETE]        -------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------Exon 1.3  PDB: B:124-147 --------------------------------------------------------------------Exon 1.5a  PDB: B:217-255 [INCOMPLETE]  Transcript 1 (2)
                 3q7q B  90 SVYKVLLLGAPGVGKSALARIFGGV---------GHTYDRSIVVDGEEASLMVYDIWE-------------MGDAYVIVYSVTDKGSFEKASELRVQLRRA----DVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLRR 255
                                    99       109    |    -    |  129       139       | -         - |     169       179       189|    | 199       209       219       229       239       249      
                                                  114       124                    147           161                          190  195                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3Q7Q)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3Q7Q)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (RAD_HUMAN | P55042)
molecular function
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0003924    GTPase activity    Catalysis of the reaction: GTP + H2O = GDP + phosphate.
    GO:0005516    calmodulin binding    Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0030308    negative regulation of cell growth    Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007264    small GTPase mediated signal transduction    Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GNP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gln A:192 - Thr A:193   [ RasMol ]  
    Gly A:112 - Gly A:113   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3q7q
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RAD_HUMAN | P55042
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RAD_HUMAN | P55042
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RAD_HUMAN | P550422dpx 2gjs 3q72 3q7p

(-) Related Entries Specified in the PDB File

2dpx 3q72 3q7p