|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 3)| Asymmetric Unit (2, 3) Biological Unit 1 (1, 2) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3Q4Q) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3Q4Q) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3Q4Q) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3Q4Q) |
Exons (0, 0)| (no "Exon" information available for 3Q4Q) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:169 aligned with Y754_METJA | Q58164 from UniProtKB/Swiss-Prot Length:185 Alignment length:169 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 Y754_METJA 12 PISEEEKEGLIEMREEEKLARDVYLTLYNKWKLQIFKNIAESEQTHMDAVKYLLEKYNIPDPVKNDSIGVFSNPKFEELYKKLVEKGDKSEVDALKVGATIEDLDIADLEKWINKTDNEDIKFVYENLMKGSRNHMRAFVRMLNNYGSNYTPQYISKEEYEEIISSSTE 180 SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -----DUF2202-3q4qA01 A:17-178 -- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3q4q A 12 PISEEEKEGLIEMREEEKLARDVYLTLYNKWKLQIFKNIAESEQTHMDAVKYLLEKYNIPDPVKNDSIGVFSNPKFEELYKKLVEKGDKSEVDALKVGATIEDLDIADLEKWINKTDNEDIKFVYENLMKGSRNHMRAFVRMLNNYGSNYTPQYISKEEYEEIISSSTE 180 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3Q4Q) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3Q4Q) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3Q4Q)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|