Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  HUMAN GUANIDINOACETATE N-METHYLTRANSFERASE WITH SAH
 
Authors :  A. Dong, H. Wu, H. Zeng, P. Loppnau, M. Sundstrom, C. H. Arrowsmith, A. M. A. Bochkarev, A. N. Plotnikov, Structural Genomics Consortium (S
Date :  07 Sep 10  (Deposition) - 15 Sep 10  (Release) - 15 Sep 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.86
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Guanidinoacetate N-Methyltransferase, Transferase, Structural Genomics, Structural Genomics Consortium, Sgc (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Wu, A. Dong, H. Zeng, P. Loppnau, M. Sundstrom, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, A. N. Plotnikov
The Crystal Structure Of Human Guanidinoacetate N-Methyltransferase With Sah
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - GUANIDINOACETATE N-METHYLTRANSFERASE
    ChainsA, B, C, D
    EC Number2.1.1.2
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28
    Expression System StrainBL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneGAMT
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)A   
Biological Unit 2 (1x) B  
Biological Unit 3 (1x)  C 
Biological Unit 4 (1x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1SAH4Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:20 , ILE A:36 , MET A:42 , MET A:50 , GLY A:68 , PHE A:69 , GLY A:70 , MET A:71 , ALA A:72 , ILE A:73 , ALA A:74 , GLU A:90 , CYS A:91 , ASN A:92 , VAL A:95 , GLY A:115 , LEU A:116 , TRP A:117 , GLU A:118 , ASP A:135 , THR A:136 , TYR A:137 , HOH A:246 , HOH A:256BINDING SITE FOR RESIDUE SAH A 4000
2AC2SOFTWARETRP B:20 , ILE B:36 , MET B:42 , MET B:50 , GLY B:68 , PHE B:69 , GLY B:70 , MET B:71 , ALA B:72 , ILE B:73 , ALA B:74 , GLU B:90 , CYS B:91 , ASN B:92 , VAL B:95 , GLY B:115 , LEU B:116 , TRP B:117 , GLU B:118 , ASP B:135 , THR B:136 , TYR B:137 , LEU B:139 , HOH B:530 , HOH B:750BINDING SITE FOR RESIDUE SAH B 4001
3AC3SOFTWARETRP C:20 , ILE C:36 , MET C:42 , MET C:50 , GLY C:68 , PHE C:69 , GLY C:70 , MET C:71 , ALA C:72 , ILE C:73 , ALA C:74 , GLU C:90 , CYS C:91 , ASN C:92 , VAL C:95 , GLY C:115 , LEU C:116 , TRP C:117 , GLU C:118 , ASP C:135 , THR C:136 , TYR C:137 , LEU C:139 , HOH C:298BINDING SITE FOR RESIDUE SAH C 4002
4AC4SOFTWARETRP D:20 , ILE D:36 , VAL D:41 , MET D:42 , MET D:50 , GLY D:68 , PHE D:69 , GLY D:70 , MET D:71 , ALA D:72 , ILE D:73 , ALA D:74 , GLU D:90 , CYS D:91 , ASN D:92 , VAL D:95 , GLY D:115 , LEU D:116 , TRP D:117 , GLU D:118 , ASP D:135 , THR D:136 , TYR D:137 , LEU D:139 , HOH D:253 , HOH D:400BINDING SITE FOR RESIDUE SAH D 4003

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3ORH)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3ORH)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (35, 139)

Asymmetric Unit (35, 139)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_071775P8TGAMT_HUMANPolymorphism776498025A/B/CP8T
02UniProtVAR_058102W20SGAMT_HUMANDisease (CCDS2)80338734A/B/C/DW20S
03UniProtVAR_071776Y27HGAMT_HUMANPolymorphism200833152A/B/C/DY27H
04UniProtVAR_075290R44LGAMT_HUMANPolymorphism200339910A/B/C/DR44L
05UniProtVAR_071777W45RGAMT_HUMANDisease (CCDS2)  ---A/B/C/DW45R
06UniProtVAR_058103M50LGAMT_HUMANDisease (CCDS2)104894694A/B/C/DM50L
07UniProtVAR_058104H51PGAMT_HUMANDisease (CCDS2)  ---A/B/C/DH51P
08UniProtVAR_058105A54PGAMT_HUMANDisease (CCDS2)  ---A/B/C/DA54P
09UniProtVAR_071778G68CGAMT_HUMANDisease (CCDS2)  ---A/B/C/DG68C
10UniProtVAR_075291M71VGAMT_HUMANPolymorphism372027428A/B/C/DM71V
11UniProtVAR_071779A75VGAMT_HUMANDisease (CCDS2)  ---A/B/C/DA75V
12UniProtVAR_075292S76LGAMT_HUMANPolymorphism150338273A/B/C/DS76L
13UniProtVAR_071780V78EGAMT_HUMANDisease (CCDS2)  ---A/B/C/DV78E
14UniProtVAR_075293V78MGAMT_HUMANPolymorphism141358977A/B/C/DV78M
15UniProtVAR_075294V95IGAMT_HUMANPolymorphism140778208A/B/C/DV95I
16UniProtVAR_075295R105QGAMT_HUMANPolymorphism148838075A/B/C/DR105Q
17UniProtVAR_075296Q106PGAMT_HUMANPolymorphism145817990A/B/C/DQ106P
18UniProtVAR_071781V110FGAMT_HUMANDisease (CCDS2)753198836A/B/C/DV110F
19UniProtVAR_071782D135NGAMT_HUMANDisease (CCDS2)774144200A/B/C/DD135N
20UniProtVAR_075297T146RGAMT_HUMANPolymorphism149821870A/B/C/DT146R
21UniProtVAR_071783H147YGAMT_HUMANDisease (CCDS2)  ---A/B/C/DH147Y
22UniProtVAR_075298A156DGAMT_HUMANPolymorphism368221789A/B/C/DA156D
23UniProtVAR_075299F157LGAMT_HUMANPolymorphism372260609A/B/C/DF157L
24UniProtVAR_071784L159PGAMT_HUMANDisease (CCDS2)  ---A/B/C/DL159P
25UniProtVAR_071785G164DGAMT_HUMANDisease (CCDS2)760101382A/B/C/DG164D
26UniProtVAR_071786L166PGAMT_HUMANDisease (CCDS2)  ---A/B/C/DL166P
27UniProtVAR_075300T167IGAMT_HUMANPolymorphism374762419A/B/C/DT167I
28UniProtVAR_071787C169RGAMT_HUMANDisease (CCDS2)  ---A/B/C/DC169R
29UniProtVAR_058106C169YGAMT_HUMANDisease (CCDS2)121909272A/B/C/DC169Y
30UniProtVAR_075301A196TGAMT_HUMANPolymorphism  ---A/B/C/DA196T
31UniProtVAR_075302A196VGAMT_HUMANPolymorphism565109128A/B/C/DA196V
32UniProtVAR_058107L197PGAMT_HUMANDisease (CCDS2)  ---A/B/C/DL197P
33UniProtVAR_071788R208PGAMT_HUMANDisease (CCDS2)767887772A/B/C/DR208P
34UniProtVAR_025723T209MGAMT_HUMANPolymorphism17851582A/B/C/DT209M
35UniProtVAR_075303A224TGAMT_HUMANPolymorphism141471799A/B/C/DA224T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (35, 35)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_071775P8TGAMT_HUMANPolymorphism776498025AP8T
02UniProtVAR_058102W20SGAMT_HUMANDisease (CCDS2)80338734AW20S
03UniProtVAR_071776Y27HGAMT_HUMANPolymorphism200833152AY27H
04UniProtVAR_075290R44LGAMT_HUMANPolymorphism200339910AR44L
05UniProtVAR_071777W45RGAMT_HUMANDisease (CCDS2)  ---AW45R
06UniProtVAR_058103M50LGAMT_HUMANDisease (CCDS2)104894694AM50L
07UniProtVAR_058104H51PGAMT_HUMANDisease (CCDS2)  ---AH51P
08UniProtVAR_058105A54PGAMT_HUMANDisease (CCDS2)  ---AA54P
09UniProtVAR_071778G68CGAMT_HUMANDisease (CCDS2)  ---AG68C
10UniProtVAR_075291M71VGAMT_HUMANPolymorphism372027428AM71V
11UniProtVAR_071779A75VGAMT_HUMANDisease (CCDS2)  ---AA75V
12UniProtVAR_075292S76LGAMT_HUMANPolymorphism150338273AS76L
13UniProtVAR_071780V78EGAMT_HUMANDisease (CCDS2)  ---AV78E
14UniProtVAR_075293V78MGAMT_HUMANPolymorphism141358977AV78M
15UniProtVAR_075294V95IGAMT_HUMANPolymorphism140778208AV95I
16UniProtVAR_075295R105QGAMT_HUMANPolymorphism148838075AR105Q
17UniProtVAR_075296Q106PGAMT_HUMANPolymorphism145817990AQ106P
18UniProtVAR_071781V110FGAMT_HUMANDisease (CCDS2)753198836AV110F
19UniProtVAR_071782D135NGAMT_HUMANDisease (CCDS2)774144200AD135N
20UniProtVAR_075297T146RGAMT_HUMANPolymorphism149821870AT146R
21UniProtVAR_071783H147YGAMT_HUMANDisease (CCDS2)  ---AH147Y
22UniProtVAR_075298A156DGAMT_HUMANPolymorphism368221789AA156D
23UniProtVAR_075299F157LGAMT_HUMANPolymorphism372260609AF157L
24UniProtVAR_071784L159PGAMT_HUMANDisease (CCDS2)  ---AL159P
25UniProtVAR_071785G164DGAMT_HUMANDisease (CCDS2)760101382AG164D
26UniProtVAR_071786L166PGAMT_HUMANDisease (CCDS2)  ---AL166P
27UniProtVAR_075300T167IGAMT_HUMANPolymorphism374762419AT167I
28UniProtVAR_071787C169RGAMT_HUMANDisease (CCDS2)  ---AC169R
29UniProtVAR_058106C169YGAMT_HUMANDisease (CCDS2)121909272AC169Y
30UniProtVAR_075301A196TGAMT_HUMANPolymorphism  ---AA196T
31UniProtVAR_075302A196VGAMT_HUMANPolymorphism565109128AA196V
32UniProtVAR_058107L197PGAMT_HUMANDisease (CCDS2)  ---AL197P
33UniProtVAR_071788R208PGAMT_HUMANDisease (CCDS2)767887772AR208P
34UniProtVAR_025723T209MGAMT_HUMANPolymorphism17851582AT209M
35UniProtVAR_075303A224TGAMT_HUMANPolymorphism141471799AA224T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (35, 35)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_071775P8TGAMT_HUMANPolymorphism776498025BP8T
02UniProtVAR_058102W20SGAMT_HUMANDisease (CCDS2)80338734BW20S
03UniProtVAR_071776Y27HGAMT_HUMANPolymorphism200833152BY27H
04UniProtVAR_075290R44LGAMT_HUMANPolymorphism200339910BR44L
05UniProtVAR_071777W45RGAMT_HUMANDisease (CCDS2)  ---BW45R
06UniProtVAR_058103M50LGAMT_HUMANDisease (CCDS2)104894694BM50L
07UniProtVAR_058104H51PGAMT_HUMANDisease (CCDS2)  ---BH51P
08UniProtVAR_058105A54PGAMT_HUMANDisease (CCDS2)  ---BA54P
09UniProtVAR_071778G68CGAMT_HUMANDisease (CCDS2)  ---BG68C
10UniProtVAR_075291M71VGAMT_HUMANPolymorphism372027428BM71V
11UniProtVAR_071779A75VGAMT_HUMANDisease (CCDS2)  ---BA75V
12UniProtVAR_075292S76LGAMT_HUMANPolymorphism150338273BS76L
13UniProtVAR_071780V78EGAMT_HUMANDisease (CCDS2)  ---BV78E
14UniProtVAR_075293V78MGAMT_HUMANPolymorphism141358977BV78M
15UniProtVAR_075294V95IGAMT_HUMANPolymorphism140778208BV95I
16UniProtVAR_075295R105QGAMT_HUMANPolymorphism148838075BR105Q
17UniProtVAR_075296Q106PGAMT_HUMANPolymorphism145817990BQ106P
18UniProtVAR_071781V110FGAMT_HUMANDisease (CCDS2)753198836BV110F
19UniProtVAR_071782D135NGAMT_HUMANDisease (CCDS2)774144200BD135N
20UniProtVAR_075297T146RGAMT_HUMANPolymorphism149821870BT146R
21UniProtVAR_071783H147YGAMT_HUMANDisease (CCDS2)  ---BH147Y
22UniProtVAR_075298A156DGAMT_HUMANPolymorphism368221789BA156D
23UniProtVAR_075299F157LGAMT_HUMANPolymorphism372260609BF157L
24UniProtVAR_071784L159PGAMT_HUMANDisease (CCDS2)  ---BL159P
25UniProtVAR_071785G164DGAMT_HUMANDisease (CCDS2)760101382BG164D
26UniProtVAR_071786L166PGAMT_HUMANDisease (CCDS2)  ---BL166P
27UniProtVAR_075300T167IGAMT_HUMANPolymorphism374762419BT167I
28UniProtVAR_071787C169RGAMT_HUMANDisease (CCDS2)  ---BC169R
29UniProtVAR_058106C169YGAMT_HUMANDisease (CCDS2)121909272BC169Y
30UniProtVAR_075301A196TGAMT_HUMANPolymorphism  ---BA196T
31UniProtVAR_075302A196VGAMT_HUMANPolymorphism565109128BA196V
32UniProtVAR_058107L197PGAMT_HUMANDisease (CCDS2)  ---BL197P
33UniProtVAR_071788R208PGAMT_HUMANDisease (CCDS2)767887772BR208P
34UniProtVAR_025723T209MGAMT_HUMANPolymorphism17851582BT209M
35UniProtVAR_075303A224TGAMT_HUMANPolymorphism141471799BA224T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (35, 35)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_071775P8TGAMT_HUMANPolymorphism776498025CP8T
02UniProtVAR_058102W20SGAMT_HUMANDisease (CCDS2)80338734CW20S
03UniProtVAR_071776Y27HGAMT_HUMANPolymorphism200833152CY27H
04UniProtVAR_075290R44LGAMT_HUMANPolymorphism200339910CR44L
05UniProtVAR_071777W45RGAMT_HUMANDisease (CCDS2)  ---CW45R
06UniProtVAR_058103M50LGAMT_HUMANDisease (CCDS2)104894694CM50L
07UniProtVAR_058104H51PGAMT_HUMANDisease (CCDS2)  ---CH51P
08UniProtVAR_058105A54PGAMT_HUMANDisease (CCDS2)  ---CA54P
09UniProtVAR_071778G68CGAMT_HUMANDisease (CCDS2)  ---CG68C
10UniProtVAR_075291M71VGAMT_HUMANPolymorphism372027428CM71V
11UniProtVAR_071779A75VGAMT_HUMANDisease (CCDS2)  ---CA75V
12UniProtVAR_075292S76LGAMT_HUMANPolymorphism150338273CS76L
13UniProtVAR_071780V78EGAMT_HUMANDisease (CCDS2)  ---CV78E
14UniProtVAR_075293V78MGAMT_HUMANPolymorphism141358977CV78M
15UniProtVAR_075294V95IGAMT_HUMANPolymorphism140778208CV95I
16UniProtVAR_075295R105QGAMT_HUMANPolymorphism148838075CR105Q
17UniProtVAR_075296Q106PGAMT_HUMANPolymorphism145817990CQ106P
18UniProtVAR_071781V110FGAMT_HUMANDisease (CCDS2)753198836CV110F
19UniProtVAR_071782D135NGAMT_HUMANDisease (CCDS2)774144200CD135N
20UniProtVAR_075297T146RGAMT_HUMANPolymorphism149821870CT146R
21UniProtVAR_071783H147YGAMT_HUMANDisease (CCDS2)  ---CH147Y
22UniProtVAR_075298A156DGAMT_HUMANPolymorphism368221789CA156D
23UniProtVAR_075299F157LGAMT_HUMANPolymorphism372260609CF157L
24UniProtVAR_071784L159PGAMT_HUMANDisease (CCDS2)  ---CL159P
25UniProtVAR_071785G164DGAMT_HUMANDisease (CCDS2)760101382CG164D
26UniProtVAR_071786L166PGAMT_HUMANDisease (CCDS2)  ---CL166P
27UniProtVAR_075300T167IGAMT_HUMANPolymorphism374762419CT167I
28UniProtVAR_071787C169RGAMT_HUMANDisease (CCDS2)  ---CC169R
29UniProtVAR_058106C169YGAMT_HUMANDisease (CCDS2)121909272CC169Y
30UniProtVAR_075301A196TGAMT_HUMANPolymorphism  ---CA196T
31UniProtVAR_075302A196VGAMT_HUMANPolymorphism565109128CA196V
32UniProtVAR_058107L197PGAMT_HUMANDisease (CCDS2)  ---CL197P
33UniProtVAR_071788R208PGAMT_HUMANDisease (CCDS2)767887772CR208P
34UniProtVAR_025723T209MGAMT_HUMANPolymorphism17851582CT209M
35UniProtVAR_075303A224TGAMT_HUMANPolymorphism141471799CA224T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (34, 34)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
02UniProtVAR_058102W20SGAMT_HUMANDisease (CCDS2)80338734DW20S
03UniProtVAR_071776Y27HGAMT_HUMANPolymorphism200833152DY27H
04UniProtVAR_075290R44LGAMT_HUMANPolymorphism200339910DR44L
05UniProtVAR_071777W45RGAMT_HUMANDisease (CCDS2)  ---DW45R
06UniProtVAR_058103M50LGAMT_HUMANDisease (CCDS2)104894694DM50L
07UniProtVAR_058104H51PGAMT_HUMANDisease (CCDS2)  ---DH51P
08UniProtVAR_058105A54PGAMT_HUMANDisease (CCDS2)  ---DA54P
09UniProtVAR_071778G68CGAMT_HUMANDisease (CCDS2)  ---DG68C
10UniProtVAR_075291M71VGAMT_HUMANPolymorphism372027428DM71V
11UniProtVAR_071779A75VGAMT_HUMANDisease (CCDS2)  ---DA75V
12UniProtVAR_075292S76LGAMT_HUMANPolymorphism150338273DS76L
13UniProtVAR_071780V78EGAMT_HUMANDisease (CCDS2)  ---DV78E
14UniProtVAR_075293V78MGAMT_HUMANPolymorphism141358977DV78M
15UniProtVAR_075294V95IGAMT_HUMANPolymorphism140778208DV95I
16UniProtVAR_075295R105QGAMT_HUMANPolymorphism148838075DR105Q
17UniProtVAR_075296Q106PGAMT_HUMANPolymorphism145817990DQ106P
18UniProtVAR_071781V110FGAMT_HUMANDisease (CCDS2)753198836DV110F
19UniProtVAR_071782D135NGAMT_HUMANDisease (CCDS2)774144200DD135N
20UniProtVAR_075297T146RGAMT_HUMANPolymorphism149821870DT146R
21UniProtVAR_071783H147YGAMT_HUMANDisease (CCDS2)  ---DH147Y
22UniProtVAR_075298A156DGAMT_HUMANPolymorphism368221789DA156D
23UniProtVAR_075299F157LGAMT_HUMANPolymorphism372260609DF157L
24UniProtVAR_071784L159PGAMT_HUMANDisease (CCDS2)  ---DL159P
25UniProtVAR_071785G164DGAMT_HUMANDisease (CCDS2)760101382DG164D
26UniProtVAR_071786L166PGAMT_HUMANDisease (CCDS2)  ---DL166P
27UniProtVAR_075300T167IGAMT_HUMANPolymorphism374762419DT167I
28UniProtVAR_071787C169RGAMT_HUMANDisease (CCDS2)  ---DC169R
29UniProtVAR_058106C169YGAMT_HUMANDisease (CCDS2)121909272DC169Y
30UniProtVAR_075301A196TGAMT_HUMANPolymorphism  ---DA196T
31UniProtVAR_075302A196VGAMT_HUMANPolymorphism565109128DA196V
32UniProtVAR_058107L197PGAMT_HUMANDisease (CCDS2)  ---DL197P
33UniProtVAR_071788R208PGAMT_HUMANDisease (CCDS2)767887772DR208P
34UniProtVAR_025723T209MGAMT_HUMANPolymorphism17851582DT209M
35UniProtVAR_075303A224TGAMT_HUMANPolymorphism141471799DA224T

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 3)

Asymmetric Unit (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_RMT2PS51559 Arginine and arginine-like N-methyltransferase domain profile.GAMT_HUMAN13-236
 
 
  3A:13-236
B:13-236
C:13-236
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_RMT2PS51559 Arginine and arginine-like N-methyltransferase domain profile.GAMT_HUMAN13-236
 
 
  1A:13-236
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_RMT2PS51559 Arginine and arginine-like N-methyltransferase domain profile.GAMT_HUMAN13-236
 
 
  1-
B:13-236
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_RMT2PS51559 Arginine and arginine-like N-methyltransferase domain profile.GAMT_HUMAN13-236
 
 
  1-
-
C:13-236
Biological Unit 4 (, 0)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_RMT2PS51559 Arginine and arginine-like N-methyltransferase domain profile.GAMT_HUMAN13-236
 
 
  0-
-
-

(-) Exons   (6, 24)

Asymmetric Unit (6, 24)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002522881aENSE00001152729chr19:1401552-1401295258GAMT_HUMAN1-61614A:7-61
B:8-61
C:7-61
D:18-61
55
54
55
44
1.2bENST000002522882bENSE00000753080chr19:1399937-1399792146GAMT_HUMAN61-109494A:61-109
B:61-109
C:61-109
D:61-109
49
49
49
49
1.3ENST000002522883ENSE00000753081chr19:1399586-139952364GAMT_HUMAN110-131224A:110-131
B:110-131
C:110-131
D:110-131
22
22
22
22
1.4aENST000002522884aENSE00000753082chr19:1399194-139912768GAMT_HUMAN131-153234A:131-153
B:131-153
C:131-153
D:131-153
23
23
23
23
1.5aENST000002522885aENSE00001699690chr19:1399025-1398915111GAMT_HUMAN154-190374A:154-190
B:154-190
C:154-190
D:154-190
37
37
37
37
1.6bENST000002522886bENSE00001055667chr19:1397498-1397089410GAMT_HUMAN191-236464A:191-236
B:191-236
C:191-236
D:191-236
46
46
46
46

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:230
 aligned with GAMT_HUMAN | Q14353 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:230
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236
           GAMT_HUMAN     7 TPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG 236
               SCOP domains d3orha_ A: Guanidinoacetate methyltransferase                                                                                                                                                                                          SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...eee.....eeee..eeeee..hhhhhhhhhhhhh...eeeeee....hhhhhhhh...eeeeeeee.hhhhhhhhhhhhhhh..eeeeee.hhhhhhhhh....eeeeee.....hhhhh.hhhhhhhhhhhhhheeeeeeeee.hhhhhhhhh.....hhhhhhhhhhhhhhhhhh.hhh.eeeeeee.............eeeeeeee.. Sec.struct. author
             SAPs(SNPs) (1) -T-----------S------H----------------LR----LP--P-------------C--V---VL-E----------------I---------QP---F------------------------N----------RY--------DL-P----D-PI-R--------------------------TP----------PM--------------T------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------M------------------------------------------------------------------------------------------Y--------------------------V---------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------SAM_RMT2  PDB: A:13-236 UniProt: 13-236                                                                                                                                                                                          PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:7-61 UniProt: 1-61 [INCOMPLETE]      ------------------------------------------------Exon 1.3              ----------------------Exon 1.5a  PDB: A:154-190            Exon 1.6b  PDB: A:191-236 UniProt: 191-236     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------Exon 1.2b  PDB: A:61-109 UniProt: 61-109         ---------------------Exon 1.4a              ----------------------------------------------------------------------------------- Transcript 1 (2)
                 3orh A   7 TPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG 236
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236

Chain B from PDB  Type:PROTEIN  Length:229
 aligned with GAMT_HUMAN | Q14353 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:229
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227         
           GAMT_HUMAN     8 PIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG 236
               SCOP domains d3orhb_ B: Guanidinoacetate methyltransferase                                                                                                                                                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhh....eee.....eeee..eeeee..hhhhhhhhhhhhh...eeeeee....hhhhhhhh...eeeeeeee.hhhhhhhhhhhhhhh..eeeeee.hhhhhhhhh....eeeeee.....hhhhh.hhhhhhhhhhhhhheeeeeeeee.hhhhhhhhh.....hhhhhhhhhhhhhhhhh..hhh.eeeeeee.............eeeeeeee.. Sec.struct. author
             SAPs(SNPs) (1) T-----------S------H----------------LR----LP--P-------------C--V---VL-E----------------I---------QP---F------------------------N----------RY--------DL-P----D-PI-R--------------------------TP----------PM--------------T------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------M------------------------------------------------------------------------------------------Y--------------------------V---------------------------------------- SAPs(SNPs) (2)
                    PROSITE -----SAM_RMT2  PDB: B:13-236 UniProt: 13-236                                                                                                                                                                                          PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: B:8-61 UniProt: 1-61 [INCOMPLETE]     ------------------------------------------------Exon 1.3              ----------------------Exon 1.5a  PDB: B:154-190            Exon 1.6b  PDB: B:191-236 UniProt: 191-236     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------Exon 1.2b  PDB: B:61-109 UniProt: 61-109         ---------------------Exon 1.4a              ----------------------------------------------------------------------------------- Transcript 1 (2)
                 3orh B   8 PIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG 236
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227         

Chain C from PDB  Type:PROTEIN  Length:230
 aligned with GAMT_HUMAN | Q14353 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:230
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236
           GAMT_HUMAN     7 TPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG 236
               SCOP domains d3orhc_ C: Guanidinoacetate methyltransferase                                                                                                                                                                                          SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhh...eee.....eeee..eeeee..hhhhhhhhhhhhh...eeeeee....hhhhhhhh...eeeeeeee.hhhhhhhhhhhhhhh..eeeeee.hhhhhhhhh....eeeeee...........hhhhhhhhhhhhhheeeeeeeee.hhhhhhhhh.....hhhhhhhhhhhhhhhhh..hhh.eeeeeee.............eeeeeeee.. Sec.struct. author
             SAPs(SNPs) (1) -T-----------S------H----------------LR----LP--P-------------C--V---VL-E----------------I---------QP---F------------------------N----------RY--------DL-P----D-PI-R--------------------------TP----------PM--------------T------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------M------------------------------------------------------------------------------------------Y--------------------------V---------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------SAM_RMT2  PDB: C:13-236 UniProt: 13-236                                                                                                                                                                                          PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: C:7-61 UniProt: 1-61 [INCOMPLETE]      ------------------------------------------------Exon 1.3              ----------------------Exon 1.5a  PDB: C:154-190            Exon 1.6b  PDB: C:191-236 UniProt: 191-236     Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------Exon 1.2b  PDB: C:61-109 UniProt: 61-109         ---------------------Exon 1.4a              ----------------------------------------------------------------------------------- Transcript 1 (2)
                 3orh C   7 TPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG 236
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236

Chain D from PDB  Type:PROTEIN  Length:219
 aligned with GAMT_HUMAN | Q14353 from UniProtKB/Swiss-Prot  Length:236

    Alignment length:219
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227         
           GAMT_HUMAN    18 PAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG 236
               SCOP domains d3orhd_ D: Guanidinoacetate methyltransferase                                                                                                                                                                               SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eee.....eeee..eeeee..hhhhhhhhhhhhh...eeeeee....hhhhhhhh...eeeeeeee.hhhhhhhhhhhhhhh..eeeeee.hhhhhhhhh....eeeeee...........hhhhhhhhhhhhhheeeeeeeee.hhhhhhhhh.....hhhhhhhhhhhhhhhhh..hhh.eeeeeee.............eeeeeeee.. Sec.struct. author
             SAPs(SNPs) (1) --S------H----------------LR----LP--P-------------C--V---VL-E----------------I---------QP---F------------------------N----------RY--------DL-P----D-PI-R--------------------------TP----------PM--------------T------------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------M------------------------------------------------------------------------------------------Y--------------------------V---------------------------------------- SAPs(SNPs) (2)
                    PROSITE SAM_RMT2  PDB: - UniProt: 13-236                                                                                                                                                                                            PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: D:18-61 UniProt: 1-61       ------------------------------------------------Exon 1.3              ----------------------Exon 1.5a  PDB: D:154-190            Exon 1.6b  PDB: D:191-236 UniProt: 191-236     Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.2b  PDB: D:61-109 UniProt: 61-109         ---------------------Exon 1.4a              ----------------------------------------------------------------------------------- Transcript 1 (2)
                 3orh D  18 PAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG 236
                                    27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0 ; only for superseded entry 1ZX0: 1,4)

(no "CATH Domain" information available for 3ORH, only for superseded entry 1ZX0 replaced by 3ORH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3ORH)

(-) Gene Ontology  (19, 19)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (GAMT_HUMAN | Q14353)
molecular function
    GO:0008757    S-adenosylmethionine-dependent methyltransferase activity    Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to a substrate.
    GO:0030731    guanidinoacetate N-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine + guanidinoacetate = S-adenosyl-L-homocysteine + creatine + H(+).
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0046498    S-adenosylhomocysteine metabolic process    The chemical reactions and pathways involving S-adenosylhomocysteine; the L-enantiomer is formed from S-adenosylmethionine and is a strong inhibitor of S-adenosylmethionine-mediated methylation reactions. It can be cleaved to form adenosine and homocysteine.
    GO:0046500    S-adenosylmethionine metabolic process    The chemical reactions and pathways involving S-adenosylmethionine, S-(5'-adenosyl)-L-methionine, an important intermediate in one-carbon metabolism.
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0006601    creatine biosynthetic process    The chemical reactions and pathways resulting in the formation of creatine, N-[amino(imino)methyl]-N-methylglycine. Creatine is formed by a process beginning with amidino group transfer from L-arginine to glycine to form guanidinoacetate, followed by methyl group transfer from S-adenosyl-L-methionine to guanidinoacetate; it is then is phosphorylated to form a pool that stores high energy phosphate for the replenishment of ATP during periods of high, or fluctuating energy demand. In animals, most creatine is transported to and used in muscle.
    GO:0006600    creatine metabolic process    The chemical reactions and pathways involving creatine (N-(aminoiminomethyl)-N-methylglycine), a compound synthesized from the amino acids arginine, glycine, and methionine that occurs in muscle.
    GO:1990402    embryonic liver development    The process occurring during the embryonic phase whose specific outcome is the progression of the liver over time, from its formation to the mature structure.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0006936    muscle contraction    A process in which force is generated within muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis.
    GO:0040014    regulation of multicellular organism growth    Any process that modulates the frequency, rate or extent of growth of the body of an organism so that it reaches its usual body size.
    GO:0007283    spermatogenesis    The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SAH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3orh)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3orh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GAMT_HUMAN | Q14353
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.2
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  612736
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GAMT_HUMAN | Q14353
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3ORH)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3ORH)