|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 6)
Asymmetric Unit (3, 6)
|
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3OC8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3OC8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3OC8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3OC8) |
Exons (0, 0)| (no "Exon" information available for 3OC8) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:134 aligned with TCPF_VIBCH | P0C6Q5 from UniProtKB/Swiss-Prot Length:338 Alignment length:134 214 224 234 244 254 264 274 284 294 304 314 324 334 TCPF_VIBCH 205 NEIYPHIKVYEGTLSRLKPGGAMIAVLEYDVNELSKHGYTNLWDVQFKVLVGVPHAETGVIYDPVYEETVKPYQPSNNLTGKKLYNVSTNDMHNGYKWSNTMFSNSNYKTQILLTKGDGSGVKLYSKAYSENFK 338 SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -TcpF-3oc8A01 A:186-317 - Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript 3oc8 A 185 MEIYPHIKVYEGTLSRLKPGGAMIAVLEYDVNELSKHGYTNLWDVQFKVLVGVPHAETGVIYDPVYEETVKPYQPSNNLTGKKLYNVSTNDMHNGYKWSNTMFSNSNYKTQILLTKGDGSGVKLYSKAYSENFK 318 194 204 214 224 234 244 254 264 274 284 294 304 314
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3OC8) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3OC8) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (2, 2)|
Asymmetric Unit(hide GO term definitions) Chain A (TCPF_VIBCH | P0C6Q5)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|