Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE RBD DOMAIN OF SERINE/THREONINE-PROTEIN KINASE B-RAF FROM HOMO SAPIENS. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET HR4694F
 
Authors :  S. Vorobiev, M. Su, J. Seetharaman, P. Patel, R. Xiao, C. Ciccosanti, R. J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, J. F. Hunt Northeast Structural Genomics Consortium (Nesg)
Date :  14 Jul 10  (Deposition) - 28 Jul 10  (Release) - 22 Feb 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.99
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C (1x),D (1x)
Biol. Unit 3:  C,D  (1x)
Keywords :  Nesg, Structural Genomics, Psi-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Vorobiev, M. Su, J. Seetharaman, P. Patel, R. Xiao, C. Ciccosanti, R. Shastry, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, J. F. Hunt, L. Tong
Crystal Structure Of The Rbd Domain Of Serine/Threonine-Protein Kinase B-Raf From Homo Sapiens.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SERINE/THREONINE-PROTEIN KINASE B-RAF
    ChainsA, B, C, D
    EC Number2.7.11.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)+ MAGIC
    Expression System Taxid469008
    Expression System VectorPET 14-15C
    FragmentRBD DOMAIN RESIDUES 153-237
    GeneBRAF, BRAF1, RAFB1
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROTO-ONCOGENE B-RAF, P94, V-RAF MURINE SARCOMA VIRAL ONCOGENE HOMOLOG B1

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (1x)  C (1x)D (1x)
Biological Unit 3 (1x)  CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric Unit (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 3)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3NY5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3NY5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3NY5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3NY5)

(-) PROSITE Motifs  (3, 8)

Asymmetric Unit (3, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RBDPS50898 Ras-binding domain (RBD) profile.BRAF_HUMAN155-227
 
 
 
  4A:155-227
B:155-227
C:155-227
D:155-227
2ZF_DAG_PE_2PS50081 Zinc finger phorbol-ester/DAG-type profile.BRAF_HUMAN234-280
 
  2B:234-235
C:234-235
3ZF_DAG_PE_1PS00479 Zinc finger phorbol-ester/DAG-type signature.BRAF_HUMAN235-280
 
  2B:235-235
C:235-235
Biological Unit 1 (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RBDPS50898 Ras-binding domain (RBD) profile.BRAF_HUMAN155-227
 
 
 
  2A:155-227
B:155-227
-
-
2ZF_DAG_PE_2PS50081 Zinc finger phorbol-ester/DAG-type profile.BRAF_HUMAN234-280
 
  1B:234-235
-
3ZF_DAG_PE_1PS00479 Zinc finger phorbol-ester/DAG-type signature.BRAF_HUMAN235-280
 
  1B:235-235
-
Biological Unit 2 (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RBDPS50898 Ras-binding domain (RBD) profile.BRAF_HUMAN155-227
 
 
 
  2-
-
C:155-227
D:155-227
2ZF_DAG_PE_2PS50081 Zinc finger phorbol-ester/DAG-type profile.BRAF_HUMAN234-280
 
  1-
C:234-235
3ZF_DAG_PE_1PS00479 Zinc finger phorbol-ester/DAG-type signature.BRAF_HUMAN235-280
 
  1-
C:235-235
Biological Unit 3 (3, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RBDPS50898 Ras-binding domain (RBD) profile.BRAF_HUMAN155-227
 
 
 
  2-
-
C:155-227
D:155-227
2ZF_DAG_PE_2PS50081 Zinc finger phorbol-ester/DAG-type profile.BRAF_HUMAN234-280
 
  1-
C:234-235
3ZF_DAG_PE_1PS00479 Zinc finger phorbol-ester/DAG-type signature.BRAF_HUMAN235-280
 
  1-
C:235-235

(-) Exons   (3, 12)

Asymmetric Unit (3, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002886021aENSE00001154485chr7:140624564-140624366199BRAF_HUMAN1-46460--
1.2ENST000002886022ENSE00001035281chr7:140550012-140549911102BRAF_HUMAN47-80340--
1.3aENST000002886023aENSE00001035295chr7:140534672-140534409264BRAF_HUMAN81-168884A:151-168
B:150-168
C:152-168
D:151-168
18
19
17
18
1.4ENST000002886024ENSE00001034889chr7:140508795-140508692104BRAF_HUMAN169-203354A:169-201
B:169-201
C:169-201
D:169-200
33
33
33
32
1.6ENST000002886026ENSE00001034814chr7:140507862-140507760103BRAF_HUMAN203-237354A:205-233
B:204-235
C:205-235
D:205-232
29
32
31
28
1.7ENST000002886027ENSE00001034880chr7:140501360-140501212149BRAF_HUMAN238-287500--
1.8ENST000002886028ENSE00001034818chr7:140500281-140500162120BRAF_HUMAN287-327410--
1.9ENST000002886029ENSE00001034830chr7:140494267-140494108160BRAF_HUMAN327-380540--
1.10ENST0000028860210ENSE00001034865chr7:140487384-14048734837BRAF_HUMAN381-393130--
1.11ENST0000028860211ENSE00001034844chr7:140482957-140482821137BRAF_HUMAN393-438460--
1.12ENST0000028860212ENSE00001034859chr7:140481493-140481376118BRAF_HUMAN439-478400--
1.13ENST0000028860213ENSE00001034883chr7:140477875-14047779185BRAF_HUMAN478-506290--
1.14ENST0000028860214ENSE00001034826chr7:140476888-140476712177BRAF_HUMAN506-565600--
1.15aENST0000028860215aENSE00001034811chr7:140454033-14045398747BRAF_HUMAN565-581170--
1.16ENST0000028860216ENSE00001034798chr7:140453193-140453075119BRAF_HUMAN581-620400--
1.17ENST0000028860217ENSE00001034817chr7:140449218-140449087132BRAF_HUMAN621-664440--
1.19ENST0000028860219ENSE00001034824chr7:140439746-140439612135BRAF_HUMAN665-709450--
1.20dENST0000028860220dENSE00001034876chr7:140434570-140434279292BRAF_HUMAN710-766570--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:80
 aligned with BRAF_HUMAN | P15056 from UniProtKB/Swiss-Prot  Length:766

    Alignment length:83
                                   160       170       180       190       200       210       220       230   
           BRAF_HUMAN   151 SPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLT 233
               SCOP domains d3ny5a_ A: automated matches                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee...eeeeee.....hhhhhhhhhhhh...hhh.eeeee..---.eee....hhhhhh..eeeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----RBD  PDB: A:155-227 UniProt: 155-227                                     ------ PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.3a         Exon 1.4  PDB: A:169-201           ------------------------------ Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.6  PDB: A:205-233        Transcript 1 (2)
                 3ny5 A 151 HmQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALmmRGLIPECCAVYRIQ---KKPIGWDTDISWLTGEELHVEVLENVPLT 233
                             |     160       170       180     ||190       200|   |  210       220       230   
                             |                               186-MSE        201 205                            
                           152-MSE                            187-MSE                                          

Chain B from PDB  Type:PROTEIN  Length:84
 aligned with BRAF_HUMAN | P15056 from UniProtKB/Swiss-Prot  Length:766

    Alignment length:86
                                   159       169       179       189       199       209       219       229      
           BRAF_HUMAN   150 KSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTH 235
               SCOP domains d3ny5b_ B: automated matches                                                           SCOP domains
               CATH domains -------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeeee...eeeeee.....hhhhhhhhhhhh...hhh.eeeee..--..eee....hhhhhh..eeeeee......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----RBD  PDB: B:155-227 UniProt: 155-227                                     ------ZF PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------Z PROSITE (2)
           Transcript 1 (1) Exon 1.3a          Exon 1.4  PDB: B:169-201           -------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------Exon 1.6  PDB: B:204-235          Transcript 1 (2)
                 3ny5 B 150 SHmQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALmmRGLIPECCAVYRIQ--EKKPIGWDTDISWLTGEELHVEVLENVPLTTH 235
                              |    159       169       179      |189       199 |  |  209       219       229      
                            152-MSE                           186-MSE        201  |                               
                                                               187-MSE          204                               

Chain C from PDB  Type:PROTEIN  Length:81
 aligned with BRAF_HUMAN | P15056 from UniProtKB/Swiss-Prot  Length:766

    Alignment length:84
                                   161       171       181       191       201       211       221       231    
           BRAF_HUMAN   152 PQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTH 235
               SCOP domains d3ny5c_ C: automated matches                                                         SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeeeee...eeeeee.....hhhhhhhhhhhh...hhh.eeeee..---.eee....hhhhhh..eeeeee......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---RBD  PDB: C:155-227 UniProt: 155-227                                     ------ZF PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------Z PROSITE (2)
           Transcript 1 (1) Exon 1.3a        Exon 1.4  PDB: C:169-201           -------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.6  PDB: C:205-235          Transcript 1 (2)
                 3ny5 C 152 mQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALmmRGLIPECCAVYRIQ---KKPIGWDTDISWLTGEELHVEVLENVPLTTH 235
                            |      161       171       181    || 191       201   |   211       221       231    
                          152-MSE                           186-MSE        201 205                              
                                                             187-MSE                                            

Chain D from PDB  Type:PROTEIN  Length:78
 aligned with BRAF_HUMAN | P15056 from UniProtKB/Swiss-Prot  Length:766

    Alignment length:82
                                   160       170       180       190       200       210       220       230  
           BRAF_HUMAN   151 SPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL 232
               SCOP domains d3ny5d_ D: automated matches                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee...eeeeee.....hhhhhhhhhhhhh..hhh.eeeee.----.ee.....hhhhhh..eeeeee...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----RBD  PDB: D:155-227 UniProt: 155-227                                     ----- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.3a         Exon 1.4  PDB: D:169-200           ----------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.6  PDB: D:205-232       Transcript 1 (2)
                 3ny5 D 151 HmQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALmmRGLIPECCAVYRI----KKPIGWDTDISWLTGEELHVEVLENVPL 232
                             |     160       170       180     ||190       200    |  210       220       230  
                           152-MSE                           186-MSE       200  205                           
                                                              187-MSE                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3NY5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3NY5)

(-) Gene Ontology  (64, 64)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (BRAF_HUMAN | P15056)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004709    MAP kinase kinase kinase activity    Catalysis of the phosphorylation and activation of a MAP kinase kinase; each MAP kinase kinase can be phosphorylated by any of several MAP kinase kinase kinases.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0031434    mitogen-activated protein kinase kinase binding    Interacting selectively and non-covalently with a mitogen-activated protein kinase kinase, any protein that can phosphorylate a MAP kinase.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0005057    signal transducer activity, downstream of receptor    Conveys a signal from an upstream receptor or intracellular signal transducer, converting the signal into a form where it can ultimately trigger a change in the state or activity of a cell.
    GO:0031267    small GTPase binding    Interacting selectively and non-covalently with a small monomeric GTPase.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0043367    CD4-positive, alpha-beta T cell differentiation    The process in which a relatively unspecialized T cell acquires specialized features of a mature CD4-positive, alpha-beta T cell.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0000186    activation of MAPKK activity    The initiation of the activity of the inactive enzyme MAP kinase kinase (MAPKK).
    GO:0046632    alpha-beta T cell differentiation    The process in which a precursor cell type acquires the specialized features of an alpha-beta T cell. An alpha-beta T cell is a T cell that expresses an alpha-beta T cell receptor complex.
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0030154    cell differentiation    The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
    GO:0071277    cellular response to calcium ion    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0035690    cellular response to drug    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0090150    establishment of protein localization to membrane    The directed movement of a protein to a specific location in a membrane.
    GO:0060324    face development    The biological process whose specific outcome is the progression of a face from an initial condition to its mature state. The face is the ventral division of the head.
    GO:0015758    glucose transport    The directed movement of the hexose monosaccharide glucose into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0060323    head morphogenesis    The process in which the anatomical structures of the head are generated and organized. The head is the anterior-most division of the body.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0060291    long-term synaptic potentiation    A process that modulates synaptic plasticity such that synapses are changed resulting in the increase in the rate, or frequency of synaptic transmission at the synapse.
    GO:0002318    myeloid progenitor cell differentiation    The process in which a precursor cell type acquires the specialized features of a myeloid progenitor cell. Myeloid progenitor cells include progenitor cells for any of the myeloid lineages.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:2000352    negative regulation of endothelial cell apoptotic process    Any process that stops, prevents or reduces the frequency, rate or extent of endothelial cell apoptotic process.
    GO:0010764    negative regulation of fibroblast migration    Any process that decreases the rate, frequency or extent of fibroblast cell migration. Fibroblast cell migration is accomplished by extension and retraction of a pseudopodium.
    GO:0043524    negative regulation of neuron apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
    GO:2000301    negative regulation of synaptic vesicle exocytosis    Any process that stops, prevents or reduces the frequency, rate or extent of synaptic vesicle exocytosis.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0043368    positive T cell selection    The process of sparing immature T cells which react with self-MHC protein complexes with low affinity levels from apoptotic death.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0048680    positive regulation of axon regeneration    Any process that activates, maintains or increases the rate of axon regeneration.
    GO:0050772    positive regulation of axonogenesis    Any process that activates or increases the frequency, rate or extent of axonogenesis.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0033138    positive regulation of peptidyl-serine phosphorylation    Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-serine.
    GO:0051496    positive regulation of stress fiber assembly    Any process that activates or increases the frequency, rate or extent of the assembly of a stress fiber, a bundle of microfilaments and other proteins found in fibroblasts.
    GO:1900026    positive regulation of substrate adhesion-dependent cell spreading    Any process that activates or increases the frequency, rate or extent of substrate adhesion-dependent cell spreading.
    GO:0051291    protein heterooligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers that are not all identical. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0048679    regulation of axon regeneration    Any process that modulates the frequency, rate or extent of axon regeneration.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0051591    response to cAMP    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
    GO:0043434    response to peptide hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a peptide hormone stimulus. A peptide hormone is any of a class of peptides that are secreted into the blood stream and have endocrine functions in living animals.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0035019    somatic stem cell population maintenance    Any process by which an organism retains a population of somatic stem cells, undifferentiated cells in the embryo or adult which can undergo unlimited division and give rise to cell types of the body other than those of the germ-line.
    GO:0048538    thymus development    The process whose specific outcome is the progression of the thymus over time, from its formation to the mature structure. The thymus is a symmetric bi-lobed organ involved primarily in the differentiation of immature to mature T cells, with unique vascular, nervous, epithelial, and lymphoid cell components.
    GO:0030878    thyroid gland development    The process whose specific outcome is the progression of the thyroid gland over time, from its formation to the mature structure. The thyroid gland is an endoderm-derived gland that produces thyroid hormone.
    GO:0008542    visual learning    Any process in an organism in which a change in behavior of an individual occurs in response to repeated exposure to a visual cue.
cellular component
    GO:0044297    cell body    The portion of a cell bearing surface projections such as axons, dendrites, cilia, or flagella that includes the nucleus, but excludes all cell projections.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3ny5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3ny5)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ny5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BRAF_HUMAN | P15056
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  BRAF_HUMAN | P15056
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BRAF_HUMAN | P150561uwh 1uwj 2fb8 2l05 3c4c 3d4q 3idp 3ii5 3og7 3ppj 3ppk 3prf 3pri 3psb 3psd 3q4c 3q96 3skc 3tv4 3tv6 4cqe 4dbn 4e26 4e4x 4ehe 4ehg 4fc0 4fk3 4g9c 4g9r 4h58 4jvg 4ksp 4ksq 4mbj 4mne 4mnf 4pp7 4r5y 4rzv 4rzw 4wo5 4xv1 4xv2 4xv3 4xv9 4yht 5c9c 5csw 5csx 5ct7 5fd2 5hi2 5hid 5hie 5ita 5j17 5j18 5j2r 5jrq 5jsm 5jt2 5val 5vam

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3NY5)