Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SENSORY BOX SENSOR HISTIDINE KINASE FROM VIBRIO CHOLERAE
 
Authors :  C. Chang, R. Wu, L. Freeman, A. Joachimiak, Midwest Center For Struc Genomics (Mcsg)
Date :  07 May 10  (Deposition) - 26 May 10  (Release) - 26 May 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.78
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Psi2, Mcsg, Structural Genomics, Protein Structure Initiative, Midwest Center For Structural Genomics, Sensor Domain, Histidine Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Chang, R. Wu, L. Freeman, A. Joachimiak
Crystal Structure Of Sensory Box Sensor Histidine Kinase From Vibrio Cholerae
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SENSOR PROTEIN
    Chains: A, B, C, D
    EC Number: 2.7.13.3
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21(DE3)MAGIC
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 1-136
    Gene: VC_1084
    Organism Scientific: VIBRIO CHOLERAE O1 BIOVAR EL TOR
    Organism Taxid: 243277
    Strain: N16961

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric/Biological Unit (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3MXQ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3MXQ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3MXQ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3MXQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3MXQ)

(-) Exons   (0, 0)

(no "Exon" information available for 3MXQ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:126
 aligned with Q9KT21_VIBCH | Q9KT21 from UniProtKB/TrEMBL  Length:439

    Alignment length:136
                                 1                                                                                                                                  
                                 |   5        15        25        35        45        55        65        75        85        95       105       115       125      
         Q9KT21_VIBCH     - -----MAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVIFDGETMQGKNILELFPESADYLKRKIDTALVIESSSFSSWEQKPHLLPFKSSRPVSGEEEQMYQNLEVIPIHSEDGTIEHVCLCVYDVTIQ 131
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhh.eeeeee....eeeehhhhhhh...hhhhhh..hhhhhh..hhhhhhhhhhhhhhhh..eeee..........----------..eeeeeeeeeee.....eeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3mxq A  -4 FQSNAmAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVIFDGETmQGKNILELFPESADYLKRKIDTALVIESSSFSSWEQKPHLLPF----------EQmYQNLEVIPIHSEDGTIEHVCLCVYDVTIQ 131
                                 |   5        15        25        35        45|       55        65        75        85   |     -    | |105       115       125      
                                 1-MSE                                       46-MSE                                     89        100 |                             
                                                                                                                                    102-MSE                         


Chain B from PDB  Type:PROTEIN  Length:119
 aligned with Q9KT21_VIBCH | Q9KT21 from UniProtKB/TrEMBL  Length:439

    Alignment length:138
                                     1                                                                                                                                
                                     1        11        21        31        41        51        61        71        81        91       101       111       121        
         Q9KT21_VIBCH     - ---------MAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVIFDGETMQGKNILELFPESADYLKRKIDTALVIESSSFSSWEQKPHLLPFKSSRPVSGEEEQMYQNLEVIPIHSEDGTIEHVCLCVYDVT 129
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhh.eeeeee....eeeehhhhhh...-----....hhhhhh..hhhhhhhhhhhhhhhh......-....-...------------...eeeeeeeee.....eeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3mxq B  -8 ENLYFQSNAmAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVI-----mQGKNILELFPESADYLKRKIDTALVIESSSFSS-EQKP-LLP------------QmYQNLEVIPIHSEDGTIEHVCLCVYDVT 129
                                     1        11        21        31        |-    |   51        61        71       |81  | | |  -       101|      111       121        
                                     1-MSE                                 40     |                               79 | 84 | |          101|                           
                                                                                 46-MSE                             81   86 |           102-MSE                       
                                                                                                                           88                                         


Chain C from PDB  Type:PROTEIN  Length:125
 aligned with Q9KT21_VIBCH | Q9KT21 from UniProtKB/TrEMBL  Length:439

    Alignment length:135
                                 1                                                                                                                                 
                                 |   5        15        25        35        45        55        65        75        85        95       105       115       125     
         Q9KT21_VIBCH     - -----MAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVIFDGETMQGKNILELFPESADYLKRKIDTALVIESSSFSSWEQKPHLLPFKSSRPVSGEEEQMYQNLEVIPIHSEDGTIEHVCLCVYDVTI 130
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhh.eeeeee....eeeehhhhhh....hhhhhh..hhhhhh..hhhhhhhhhhhhhhhh..eeee...........----------.eeeeeeeeeee.....eeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3mxq C  -4 FQSNAmAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVIFDGETmQGKNILELFPESADYLKRKIDTALVIESSSFSSWEQKPHLLPFK----------QmYQNLEVIPIHSEDGTIEHVCLCVYDVTI 130
                                 |   5        15        25        35        45|       55        65        75        85    |    -     ||105       115       125     
                                 1-MSE                                       46-MSE                                      90        101|                            
                                                                                                                                    102-MSE                        


Chain D from PDB  Type:PROTEIN  Length:117
 aligned with Q9KT21_VIBCH | Q9KT21 from UniProtKB/TrEMBL  Length:439

    Alignment length:135
                                   1                                                                                                                               
                                   | 3        13        23        33        43        53        63        73        83        93       103       113       123     
         Q9KT21_VIBCH     - -------MAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVIFDGETMQGKNILELFPESADYLKRKIDTALVIESSSFSSWEQKPHLLPFKSSRPVSGEEEQMYQNLEVIPIHSEDGTIEHVCLCVYDV 128
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ------------------PAS_4-3mxqD01 D:12-128                                                                                                Pfam domains (1)
           Pfam domains (2) ------------------PAS_4-3mxqD02 D:12-128                                                                                                Pfam domains (2)
           Pfam domains (3) ------------------PAS_4-3mxqD03 D:12-128                                                                                                Pfam domains (3)
           Pfam domains (4) ------------------PAS_4-3mxqD04 D:12-128                                                                                                Pfam domains (4)
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh.eeeeee....eeeehhhhhh...--.......hhhhhh..hhhhhhhhhhhhhhhh..eee.-......---------------..eeeeeeeee.....eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3mxq D  -6 LYFQSNAmAKSRLLLSELLDQLSFALCIVRNDYVIVKVNEYFESRVI--GETmQGKNILELFPESADYLKRKIDTALVIESSSFSS-EQKPHL---------------mYQNLEVIPIHSEDGTIEHVCLCVYDV 128
                                   | 3        13        23        33      | 43  |     53        63        73     | |83  |      -       103       113       123     
                                   1-MSE                                 40 43  |                               79 |   86             102-MSE                      
                                                                               46-MSE                             81
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3MXQ)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3MXQ)

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Clan: PAS_Fold (84)
(-)
Family: PAS_4 (5)
(-)
Vibrio cholerae (1)
1aPAS_4-3mxqD01D:12-128
1bPAS_4-3mxqD02D:12-128
1cPAS_4-3mxqD03D:12-128
1dPAS_4-3mxqD04D:12-128

(-) Gene Ontology  (11, 11)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (Q9KT21_VIBCH | Q9KT21)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0000155    phosphorelay sensor kinase activity    Catalysis of the phosphorylation of a histidine residue in response to detection of an extracellular signal such as a chemical ligand or change in environment, to initiate a change in cell state or activity. The two-component sensor is a histidine kinase that autophosphorylates a histidine residue in its active site. The phosphate is then transferred to an aspartate residue in a downstream response regulator, to trigger a response.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016772    transferase activity, transferring phosphorus-containing groups    Catalysis of the transfer of a phosphorus-containing group from one compound (donor) to another (acceptor).
biological process
    GO:0000160    phosphorelay signal transduction system    A conserved series of molecular signals found in prokaryotes and eukaryotes; involves autophosphorylation of a histidine kinase and the transfer of the phosphate group to an aspartate that then acts as a phospho-donor to response regulator proteins.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3mxq)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3mxq)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3mxq
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9KT21_VIBCH | Q9KT21
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.7.13.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9KT21_VIBCH | Q9KT21
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3MXQ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3MXQ)