3MDY - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE CYTOPLASMIC DOMAIN OF THE BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE-1B (BMPR1B) IN COMPLEX WITH FKBP12 AND LDN-193189

Authors :   A. Chaikuad, C. Sanvitale, P. Mahajan, N. Daga, C. Cooper, T. Krojer, I. S. Knapp, F. Von Delft, J. Weigelt, C. H. Arrowsmith, A. M. Edwards, C. A. Bullock, Structural Genomics Consortium (Sgc)

Date :   31 Mar 10 (Deposition) - 19 May 10 (Release) - 19 May 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.05

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Complex (Isomerase-Protein Kinase), Receptor Serine/Threonine Kinase, Structural Genomics Consortium, Sgc, Atp-Binding, Disease Mutation, Kinase, Transferase, Rotamase, Transferase-Isomerase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. Chaikuad, C. Sanvitale, P. Mahajan, N. Daga, C. Cooper, T. Krojer, I. Alfano, S. Knapp, F. Von Delft, J. Weigelt, C. H. Arrowsmith, A. M. Edwards, C. Bountra, A. Bullock, Structural Genomics Consortium (Sgc)
Crystal Structure Of The Cytoplasmic Domain Of The Bone Morphogenetic Protein Receptor Type-1B (Bmpr1B) In Complex With Fkbp12 And Ldn-193189
To Be Published
PubMed: search

Molecule 1 - BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE-1B
	Chains	:	A, C
	EC Number	:	2.7.11.30
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Cell Line	:	SF9
	Expression System Common	:	FALL ARMYWORM
	Expression System Plasmid	:	PFB-LIC-BSE
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACULOVIRUS
	Fragment	:	BMPR1B CYTOPLASMIC (GS AND KINASE) DOMAIN (RESIDUE 168- 502)
	Gene	:	BMPR1B
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	BMPR1B, BMP TYPE-1B RECEPTOR, BMPR-1B

Molecule 2 - PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP1A
	Chains	:	B, D
	EC Number	:	5.2.1.8
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PNIC28-BSA4
	Expression System Strain	:	BL21(DE3)-R3
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	FKBP12
	Gene	:	FKBP12
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	FKBP12, PPIASE FKBP1A, FK506-BINDING PROTEIN 1A, FKBP-1A, ROTAMASE, IMMUNOPHILIN FKBP12, 12 KDA FK506-BINDING PROTEIN, 12 KDA FKBP, FKBP-12

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	LDN	2	Ligand/Ion	4-[6-(4-PIPERAZIN-1-YLPHENYL)PYRAZOLO[1,5-A]PYRIMIDIN-3-YL]QUINOLINE

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	LDN	1	Ligand/Ion	4-[6-(4-PIPERAZIN-1-YLPHENYL)PYRAZOLO[1,5-A]PYRIMIDIN-3-YL]QUINOLINE

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	LDN	1	Ligand/Ion	4-[6-(4-PIPERAZIN-1-YLPHENYL)PYRAZOLO[1,5-A]PYRIMIDIN-3-YL]QUINOLINE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:65 , ILE A:210 , ALA A:229 , LEU A:259 , THR A:279 , ASP A:280 , HIS A:282 , GLU A:283 , GLY A:285 , ASP A:289 , LYS A:336 , ASN A:337 , LEU A:339 , ASP A:350 , HOH A:527 , HOH A:715	BINDING SITE FOR RESIDUE LDN A 1
2	AC2	SOFTWARE	HOH C:76 , HOH C:93 , ILE C:210 , ALA C:229 , LEU C:259 , THR C:279 , ASP C:280 , HIS C:282 , GLU C:283 , GLY C:285 , ASP C:289 , LYS C:336 , ASN C:337 , LEU C:339 , ASP C:350 , HOH C:613 , HOH C:681	BINDING SITE FOR RESIDUE LDN C 1

(no "SS Bond" information available for 3MDY)

(no "Cis Peptide Bond" information available for 3MDY)

Asymmetric Unit (7, 14)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_023819	I	200	K	BMR1B_HUMAN	Disease (BDA2)	28939703	A/C	I	200	K
2	UniProt	VAR_041403	R	224	H	BMR1B_HUMAN	Polymorphism	35973133	A/C	R	224	H
3	UniProt	VAR_041404	D	297	N	BMR1B_HUMAN	Unclassified	---	A/C	D	297	N
4	UniProt	VAR_076406	K	325	N	BMR1B_HUMAN	Disease (BDA1D)	869025614	A/C	K	325	N
5	UniProt	VAR_041405	R	371	Q	BMR1B_HUMAN	Polymorphism	34970181	A/C	R	371	Q
6	UniProt	VAR_037967	R	486	Q	BMR1B_HUMAN	Disease (BDA2)	121434419	A/C	R	486	Q
7	UniProt	VAR_023820	R	486	W	BMR1B_HUMAN	Disease (BDA2)	28939704	A/C	R	486	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_023819	I	200	K	BMR1B_HUMAN	Disease (BDA2)	28939703	A	I	200	K
2	UniProt	VAR_041403	R	224	H	BMR1B_HUMAN	Polymorphism	35973133	A	R	224	H
3	UniProt	VAR_041404	D	297	N	BMR1B_HUMAN	Unclassified	---	A	D	297	N
4	UniProt	VAR_076406	K	325	N	BMR1B_HUMAN	Disease (BDA1D)	869025614	A	K	325	N
5	UniProt	VAR_041405	R	371	Q	BMR1B_HUMAN	Polymorphism	34970181	A	R	371	Q
6	UniProt	VAR_037967	R	486	Q	BMR1B_HUMAN	Disease (BDA2)	121434419	A	R	486	Q
7	UniProt	VAR_023820	R	486	W	BMR1B_HUMAN	Disease (BDA2)	28939704	A	R	486	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (7, 7)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_023819	I	200	K	BMR1B_HUMAN	Disease (BDA2)	28939703	C	I	200	K
2	UniProt	VAR_041403	R	224	H	BMR1B_HUMAN	Polymorphism	35973133	C	R	224	H
3	UniProt	VAR_041404	D	297	N	BMR1B_HUMAN	Unclassified	---	C	D	297	N
4	UniProt	VAR_076406	K	325	N	BMR1B_HUMAN	Disease (BDA1D)	869025614	C	K	325	N
5	UniProt	VAR_041405	R	371	Q	BMR1B_HUMAN	Polymorphism	34970181	C	R	371	Q
6	UniProt	VAR_037967	R	486	Q	BMR1B_HUMAN	Disease (BDA2)	121434419	C	R	486	Q
7	UniProt	VAR_023820	R	486	W	BMR1B_HUMAN	Disease (BDA2)	28939704	C	R	486	W

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (4, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FKBP_PPIASE	PS50059	FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.	FKB1A_HUMAN	20-108	2	B:20-108 D:20-108
2	GS	PS51256	GS domain profile.	BMR1B_HUMAN	174-203	2	A:174-203 C:174-203
3	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	BMR1B_HUMAN	210-231	2	A:210-231 C:210-231
4	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	BMR1B_HUMAN	328-340	2	A:328-340 C:328-340

Biological Unit 1 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FKBP_PPIASE	PS50059	FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.	FKB1A_HUMAN	20-108	1	B:20-108 -
2	GS	PS51256	GS domain profile.	BMR1B_HUMAN	174-203	1	A:174-203 -
3	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	BMR1B_HUMAN	210-231	1	A:210-231 -
4	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	BMR1B_HUMAN	328-340	1	A:328-340 -

Biological Unit 2 (4, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FKBP_PPIASE	PS50059	FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.	FKB1A_HUMAN	20-108	1	- D:20-108
2	GS	PS51256	GS domain profile.	BMR1B_HUMAN	174-203	1	- C:174-203
3	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	BMR1B_HUMAN	210-231	1	- C:210-231
4	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	BMR1B_HUMAN	328-340	1	- C:328-340

Asymmetric Unit (4, 8)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000400137	1a	ENSE00001561754	chr20:1373806-1373606	201	FKB1A_HUMAN	1-13	13	2	B:1-13 D:1-13	13 13
1.1f	ENST00000400137	1f	ENSE00001107838	chr20:1373525-1373478	48	FKB1A_HUMAN	13-29	17	2	B:13-29 D:13-29	17 17
1.4	ENST00000400137	4	ENSE00000858591	chr20:1356247-1356135	113	FKB1A_HUMAN	29-66	38	2	B:29-66 D:29-66	38 38
1.5a	ENST00000400137	5a	ENSE00000858590	chr20:1352884-1352720	165	FKB1A_HUMAN	67-108	42	2	B:67-108 D:67-108	42 42
1.7f	ENST00000400137	7f	ENSE00001872186	chr20:1350716-1349622	1095	FKB1A_HUMAN	-	0	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:320
 aligned with BMR1B_HUMAN | O00238 from UniProtKB/Swiss-Prot  Length:502

    Alignment length:329
                                   183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493         
          BMR1B_HUMAN   174 ESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL 502
               SCOP domains d3mdya_ A: automated matches                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh.....hhhhhhhhhhhheeeeeeeee..eeeeeeee..eeeeeeeee..hhhhhhhhhhhhh...........eeeeeee.hhhh.eeeeee......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..........ee........eee.....eee......ee..---------......hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh..... Sec.struct. author
             SAPs(SNPs) (1) --------------------------K-----------------------H------------------------------------------------------------------------N---------------------------N---------------------------------------------Q------------------------------------------------------------------------------------------------------------------Q---------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W---------------- SAPs(SNPs) (2)
                    PROSITE GS  PDB: A:174-203            ------PROTEIN_KINASE_ATP    ------------------------------------------------------------------------------------------------PROTEIN_KINAS------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3mdy A 174 ESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFI---------PNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL 502
                                   183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353    |    -    |  373       383       393       403       413       423       433       443       453       463       473       483       493         
                                                                                                                                                                                                                  358       368

Chain B from PDB  Type:PROTEIN  Length:109
 aligned with FKB1A_HUMAN | P62942 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:109
                             1                                                                                                           
                             |       9        19        29        39        49        59        69        79        89        99         
          FKB1A_HUMAN     - -MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE 108
               SCOP domains d3mdyb_ B: FK-506 binding protein (FKBP12), an immunophilin                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee............eeeeeeeeee....eeee.......eeee......hhhhhhhhhh.....eeeeee.hhhh...............eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------FKBP_PPIASE  PDB: B:20-108 UniProt: 20-108                                                PROSITE
           Transcript 1 (1) -Exon 1.1a    ---------------Exon 1.4  PDB: B:29-66 UniProt: 29-66 Exon 1.5a  PDB: B:67-108 UniProt: 67-108   Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.1f        ------------------------------------------------------------------------------- Transcript 1 (2)
                 3mdy B   0 SMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE 108
                                     9        19        29        39        49        59        69        79        89        99

Chain C from PDB  Type:PROTEIN  Length:320
 aligned with BMR1B_HUMAN | O00238 from UniProtKB/Swiss-Prot  Length:502

    Alignment length:327
                                   183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       
          BMR1B_HUMAN   174 ESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDI 500
               SCOP domains d3mdyc_ C: automated matches                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) TGF_beta_GS-3mdyC03 C:174-202-Pkinase-3mdyC01 C:204-491                                                                                                                                                                                                                                                                       --------- Pfam domains (1)
           Pfam domains (2) TGF_beta_GS-3mdyC04 C:174-202-Pkinase-3mdyC02 C:204-491                                                                                                                                                                                                                                                                       --------- Pfam domains (2)
         Sec.struct. author .hhhhhhhhhhhhh.....hhhhhhhhhhhheeeeeeeee..eeeeeeee..eeeeeeeee..hhhhhhhhhhhhh...........eeeeeee.hhhh.eeeeee......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..........ee........eee.....eee......ee..-------........hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) --------------------------K-----------------------H------------------------------------------------------------------------N---------------------------N---------------------------------------------Q------------------------------------------------------------------------------------------------------------------Q-------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W-------------- SAPs(SNPs) (2)
                    PROSITE GS  PDB: C:174-203            ------PROTEIN_KINASE_ATP    ------------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3mdy C 174 ESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFI-------IPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDI 500
                                   183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353    |    -  |    373       383       393       403       413       423       433       443       453       463       473       483       493       
                                                                                                                                                                                                                  358     366

Chain D from PDB  Type:PROTEIN  Length:109
 aligned with FKB1A_HUMAN | P62942 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:109
                             1                                                                                                           
                             |       9        19        29        39        49        59        69        79        89        99         
          FKB1A_HUMAN     - -MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE 108
               SCOP domains d3mdyd_ D: FK-506 binding protein (FKBP12), an immunophilin                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------FKBP_C-3mdyD01 D:13-105                                                                      --- Pfam domains (1)
           Pfam domains (2) -------------FKBP_C-3mdyD02 D:13-105                                                                      --- Pfam domains (2)
         Sec.struct. author ...eeeeeee............eeeeeeeeee....eeee.......eeee......hhhhhhhhhh.....eeeeee.hhhh...............eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------FKBP_PPIASE  PDB: D:20-108 UniProt: 20-108                                                PROSITE
           Transcript 1 (1) -Exon 1.1a    ---------------Exon 1.4  PDB: D:29-66 UniProt: 29-66 Exon 1.5a  PDB: D:67-108 UniProt: 67-108   Transcript 1 (1)
           Transcript 1 (2) -------------Exon 1.1f        ------------------------------------------------------------------------------- Transcript 1 (2)
                 3mdy D   0 SMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE 108
                                     9        19        29        39        49        59        69        79        89        99

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 3MDY)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: PKinase (934)

Family: Pkinase (680)

Homo sapiens (Human) (521)

1a	Pkinase-3mdyC01	C:204-491
1b	Pkinase-3mdyC02	C:204-491

Clan: no clan defined [family: FKBP_C] (58)

Family: FKBP_C (58)

Homo sapiens (Human) (26)

2a	FKBP_C-3mdyD01	D:13-105
2b	FKBP_C-3mdyD02	D:13-105

Clan: no clan defined [family: TGF_beta_GS] (12)

Family: TGF_beta_GS (12)

Homo sapiens (Human) (12)

3a	TGF_beta_GS-3mdyC03	C:174-202
3b	TGF_beta_GS-3mdyC04	C:174-202

Asymmetric Unit(hide GO term definitions)

Chain A,C (BMR1B_HUMAN | O00238)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0046332	SMAD binding	Interacting selectively and non-covalently with a SMAD signaling protein.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0004702	signal transducer, downstream of receptor, with serine/threonine kinase activity	Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0005025	transforming growth factor beta receptor activity, type I	Combining with a complex of transforming growth factor beta and a type II TGF-beta receptor to initiate a change in cell activity; upon binding, acts as a downstream transducer of TGF-beta signals.
	GO:0004675	transmembrane receptor protein serine/threonine kinase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
biological process
	GO:0030509	BMP signaling pathway	A series of molecular signals initiated by the binding of a member of the BMP (bone morphogenetic protein) family to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0043010	camera-type eye development	The process whose specific outcome is the progression of the camera-type eye over time, from its formation to the mature structure. The camera-type eye is an organ of sight that receives light through an aperture and focuses it through a lens, projecting it on a photoreceptor field.
	GO:0001502	cartilage condensation	The condensation of mesenchymal cells that have been committed to differentiate into chondrocytes.
	GO:0051216	cartilage development	The process whose specific outcome is the progression of a cartilage element over time, from its formation to the mature structure. Cartilage elements are skeletal elements that consist of connective tissue dominated by extracellular matrix containing collagen type II and large amounts of proteoglycan, particularly chondroitin sulfate.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0071773	cellular response to BMP stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bone morphogenetic protein (BMP) stimulus.
	GO:0002063	chondrocyte development	The process whose specific outcome is the progression of a chondrocyte over time, from its commitment to its mature state. Chondrocyte development does not include the steps involved in committing a chondroblast to a chondrocyte fate.
	GO:0002062	chondrocyte differentiation	The process in which a chondroblast acquires specialized structural and/or functional features of a chondrocyte. A chondrocyte is a polymorphic cell that forms cartilage.
	GO:0009953	dorsal/ventral pattern formation	The regionalization process in which the areas along the dorsal/ventral axis are established that will lead to differences in cell differentiation. The dorsal/ventral axis is defined by a line that runs orthogonal to both the anterior/posterior and left/right axes. The dorsal end is defined by the upper or back side of an organism. The ventral end is defined by the lower or front side of an organism.
	GO:0060350	endochondral bone morphogenesis	The process in which bones are generated and organized as a result of the conversion of initial cartilaginous anlage into bone.
	GO:0001654	eye development	The process whose specific outcome is the progression of the eye over time, from its formation to the mature structure. The eye is the organ of sight.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0035108	limb morphogenesis	The process in which the anatomical structures of a limb are generated and organized. A limb is a paired appendage of a tetrapod used for locomotion or grasping.
	GO:1902731	negative regulation of chondrocyte proliferation	Any process that stops, prevents, or reduces the frequency, rate or extent of the multiplication or reproduction of chondrocytes by cell division, resulting in the expansion of their population. A chondrocyte is a polymorphic cell that forms cartilage.
	GO:0001550	ovarian cumulus expansion	Increase in size of the cumulus surrounding the oocyte including change in morphology due to proliferation and dispersion of cumulus cells.
	GO:0042698	ovulation cycle	The type of sexual cycle seen in females, often with physiologic changes in the endometrium that recur at regular intervals during the reproductive years.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0030501	positive regulation of bone mineralization	Any process that activates or increases the frequency, rate or extent of bone mineralization.
	GO:0061036	positive regulation of cartilage development	Any process that increases the rate, frequency, or extent of cartilage development, the process whose specific outcome is the progression of the cartilage over time, from its formation to the mature structure. Cartilage is a connective tissue dominated by extracellular matrix containing collagen type II and large amounts of proteoglycan, particularly chondroitin sulfate.
	GO:0045597	positive regulation of cell differentiation	Any process that activates or increases the frequency, rate or extent of cell differentiation.
	GO:0032332	positive regulation of chondrocyte differentiation	Any process that activates or increases the frequency, rate or extent of chondrocyte differentiation.
	GO:1902043	positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	Any process that activates or increases the frequency, rate or extent of extrinsic apoptotic signaling pathway via death domain receptors.
	GO:0045669	positive regulation of osteoblast differentiation	Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0030166	proteoglycan biosynthetic process	The chemical reactions and pathways resulting in the formation of proteoglycans, any glycoprotein in which the carbohydrate units are glycosaminoglycans.
	GO:0060041	retina development in camera-type eye	The process whose specific outcome is the progression of the retina over time, from its formation to the mature structure. The retina is the innermost layer or coating at the back of the eyeball, which is sensitive to light and in which the optic nerve terminates.
	GO:0031290	retinal ganglion cell axon guidance	The process in which the migration of an axon growth cone of a retinal ganglion cell (RGC) is directed to its target in the brain in response to a combination of attractive and repulsive cues.
	GO:0023014	signal transduction by protein phosphorylation	A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
	GO:0001501	skeletal system development	The process whose specific outcome is the progression of the skeleton over time, from its formation to the mature structure. The skeleton is the bony framework of the body in vertebrates (endoskeleton) or the hard outer envelope of insects (exoskeleton or dermoskeleton).
	GO:0007178	transmembrane receptor protein serine/threonine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses serine/threonine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:1990712	HFE-transferrin receptor complex	A protein complex containing at least HFE and a transferrin receptor (either TFR1/TFRC or TFR2), proposed to play a role in the sensing of transferrin-bound Fe (Fe2-Tf) on the plasma membrane to regulate hepcidin transcription.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043235	receptor complex	Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

Chain B,D (FKB1A_HUMAN | P62942)

molecular function
	GO:0005528	FK506 binding	Interacting selectively and non-covalently with the 23-membered macrolide lactone FK506.
	GO:0046332	SMAD binding	Interacting selectively and non-covalently with a SMAD signaling protein.
	GO:0048185	activin binding	Interacting selectively and non-covalently with activin, a dimer of inhibin-beta subunits.
	GO:0019855	calcium channel inhibitor activity	Stops, prevents, or reduces the activity of a calcium channel.
	GO:0044325	ion channel binding	Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
	GO:0005527	macrolide binding	Interacting selectively and non-covalently with a macrolide, any of a large group of structurally related antibiotics produced by Streptomyces species.
	GO:0003755	peptidyl-prolyl cis-trans isomerase activity	Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
	GO:0005160	transforming growth factor beta receptor binding	Interacting selectively and non-covalently with the transforming growth factor beta receptor.
	GO:0034713	type I transforming growth factor beta receptor binding	Interacting selectively and non-covalently with a type I transforming growth factor beta receptor.
biological process
	GO:0006458	'de novo' protein folding	The process of assisting in the folding of a nascent peptide chain into its correct tertiary structure.
	GO:0007183	SMAD protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex that contains SMAD proteins.
	GO:0042110	T cell activation	The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:1990000	amyloid fibril formation	The generation of amyloid fibrils, insoluble fibrous protein aggregates exhibiting beta sheet structure, from proteins. An example of this is seen when human RIP1 and RIP3 kinases form a heterodimeric functional amyloid signaling complex (PMID:22817896).
	GO:0070588	calcium ion transmembrane transport	A process in which a calcium ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0061077	chaperone-mediated protein folding	The process of inhibiting aggregation and assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that is dependent on interaction with a chaperone.
	GO:0003007	heart morphogenesis	The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0060347	heart trabecula formation	The process of creating a trabecula in the heart. A trabecula is a tissue element in the form of a small beam, strut or rod.
	GO:0051280	negative regulation of release of sequestered calcium ion into cytosol	Any process that stops, prevents, or reduces the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
	GO:0060315	negative regulation of ryanodine-sensitive calcium-release channel activity	Any process that decreases the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
	GO:0032092	positive regulation of protein binding	Any process that activates or increases the frequency, rate or extent of protein binding.
	GO:0031398	positive regulation of protein ubiquitination	Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
	GO:0022417	protein maturation by protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that results in the attainment of the full functional capacity of a protein.
	GO:0000413	protein peptidyl-prolyl isomerization	The modification of a protein by cis-trans isomerization of a proline residue.
	GO:0042026	protein refolding	The process carried out by a cell that restores the biological activity of an unfolded or misfolded protein, using helper proteins such as chaperones.
	GO:0032925	regulation of activin receptor signaling pathway	Any process that modulates the frequency, rate or extent of the activity of any activin receptor signaling pathway.
	GO:1902991	regulation of amyloid precursor protein catabolic process	Any process that modulates the frequency, rate or extent of amyloid precursor protein catabolic process.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0032880	regulation of protein localization	Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location.
	GO:0060314	regulation of ryanodine-sensitive calcium-release channel activity	Any process that modulates the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
	GO:0007179	transforming growth factor beta receptor signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0055010	ventricular cardiac muscle tissue morphogenesis	The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
	GO:0030018	Z disc	Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0031012	extracellular matrix	A structure lying external to one or more cells, which provides structural support for cells or tissues.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0014802	terminal cisterna	The portion of sarcoplasmic reticulum devoted to calcium ion storage and calcium ion release.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		LDN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3mdy)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3mdy
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BMR1B_HUMAN \| O00238
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	FKB1A_HUMAN \| P62942
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.11.30
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	5.2.1.8
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	112600
		Disease Information	:	OMIM
	616849
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BMR1B_HUMAN \| O00238
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	FKB1A_HUMAN \| P62942
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 3MDY)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (7, 14)

PROSITE Motifs (4, 8)

Exons (4, 8)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (3, 6)

Gene Ontology (92, 95)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File