|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)| Asymmetric/Biological Unit (3, 4) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3LUU) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3LUU) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3LUU) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3LUU) |
Exons (0, 0)| (no "Exon" information available for 3LUU) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:89 aligned with B7J6R7_ACIF2 | B7J6R7 from UniProtKB/TrEMBL Length:100 Alignment length:99 11 21 31 41 51 61 71 81 91 B7J6R7_ACIF2 2 SDPRTQPLEIRPLMISRVMEVDWADGHTSRLTFEHLRVECPCAECKGHTPDQAQIVTGKEHVSVVEVVPVGHYAVQLHFSDGHNTGIFTWEYLRRLDAE 100 SCOP domains --------------------------------------------------------------------------------------------------- SCOP domains CATH domains --------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------DUF971-3luuA01 A:10-95 ----- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 3luu A 2 SDPRTQPLEIRPLmISRVmEVDWADGHTSRLTFEHLRVECPC----------AQIVTGKEHVSVVEVVPVGHYAVQLHFSDGHNTGIFTWEYLRRLDAE 100 11 | 21 31 41 | - | 61 71 81 91 15-MSE| 43 54 20-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3LUU) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3LUU) |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (1, 1)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (B7J6R7_ACIF2 | B7J6R7)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|