Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF DOMAIN OF UNKNOWN FUNCTION DUF59 FROM BACILLUS ANTHRACIS
 
Authors :  Y. Kim, M. Gu, K. Kwon, W. F. Anderson, A. Joachimiak, Center For Structural Genomics Of Infectious Diseases (Csgid)
Date :  02 Feb 10  (Deposition) - 16 Feb 10  (Release) - 16 Feb 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Biol. Unit 5:  E  (1x)
Biol. Unit 6:  F  (1x)
Keywords :  Alpha-Beta Fold, Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Csgid, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Kim, M. Gu, K. Kwon, W. F. Anderson, A. Joachimiak
Crystal Structure Of Domain Of Unknown Function Duf59 Bacillus Anthracis
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE UNCHARACTERIZED PROTEIN
    ChainsA, B, C, D, E, F
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG7
    Expression System StrainBL21 MAGIC
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneBAS4906, BA_5281, GBAA5281, GBAA_5281
    Organism CommonANTHRAX,ANTHRAX BACTERIUM
    Organism ScientificBACILLUS ANTHRACIS
    Organism Taxid1392

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)A     
Biological Unit 2 (1x) B    
Biological Unit 3 (1x)  C   
Biological Unit 4 (1x)   D  
Biological Unit 5 (1x)    E 
Biological Unit 6 (1x)     F

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 36)

Asymmetric Unit (1, 36)
No.NameCountTypeFull Name
1MSE36Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 5 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 6 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3LNO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3LNO)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric Unit
No.Residues
1Asn A:85 -Pro A:86
2Asn B:85 -Pro B:86
3Asn C:85 -Pro C:86
4Asn D:85 -Pro D:86
5Asn E:85 -Pro E:86
6Asn F:85 -Pro F:86

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3LNO)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3LNO)

(-) Exons   (0, 0)

(no "Exon" information available for 3LNO)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:106
 aligned with Q81XF6_BACAN | Q81XF6 from UniProtKB/TrEMBL  Length:105

    Alignment length:106
                              1                                                                                                       
                              |      8        18        28        38        48        58        68        78        88        98      
         Q81XF6_BACAN     - --MSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIR 104
               SCOP domains d3lnoa_ A: automated matches                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh..............eeeeee.....eeeee........hhhhhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 3lno A  -1 NAmSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITmTmTSIGCPmAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERmSRmAKIALGIR 104
                              |      8        18        28        38        48|      |58        68        78        88    |  |98      
                              |                                            47-MSE   56-MSE                               93-MSE       
                              1-MSE                                          49-MSE                                         96-MSE    

Chain B from PDB  Type:PROTEIN  Length:107
 aligned with Q81XF6_BACAN | Q81XF6 from UniProtKB/TrEMBL  Length:105

    Alignment length:107
                              1                                                                                                        
                              |      8        18        28        38        48        58        68        78        88        98       
         Q81XF6_BACAN     - --MSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIRD 105
               SCOP domains d3lnob_ B: automated matches                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhh...ee....ee......eeeeee.....eeeee........hhhhhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 3lno B  -1 NAmSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITmTmTSIGCPmAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERmSRmAKIALGIRD 105
                              |      8        18        28        38        48|      |58        68        78        88    |  |98       
                              1-MSE                                        47-MSE   56-MSE                               93-MSE        
                                                                             49-MSE                                         96-MSE     

Chain C from PDB  Type:PROTEIN  Length:106
 aligned with Q81XF6_BACAN | Q81XF6 from UniProtKB/TrEMBL  Length:105

    Alignment length:106
                              1                                                                                                       
                              |      8        18        28        38        48        58        68        78        88        98      
         Q81XF6_BACAN     - --MSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIR 104
               SCOP domains d3lnoc_ C: automated matches                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh..............eeeeee.....eeeee........hhhhhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 3lno C  -1 NAmSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITmTmTSIGCPmAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERmSRmAKIALGIR 104
                              |      8        18        28        38        48|      |58        68        78        88    |  |98      
                              1-MSE                                        47-MSE   56-MSE                               93-MSE       
                                                                             49-MSE                                         96-MSE    

Chain D from PDB  Type:PROTEIN  Length:107
 aligned with Q81XF6_BACAN | Q81XF6 from UniProtKB/TrEMBL  Length:105

    Alignment length:107
                               1                                                                                                       
                               |     7        17        27        37        47        57        67        77        87        97       
         Q81XF6_BACAN     - ---MSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIR 104
               SCOP domains d3lnod_ D: automated matches                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh..............eeeeee.....eeeee........hhhhhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 3lno D  -2 SNAmSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITmTmTSIGCPmAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERmSRmAKIALGIR 104
                               |     7        17        27        37        47 |      57        67        77        87     |  97       
                               1-MSE                                        47-MSE   56-MSE                               93-MSE       
                                                                              49-MSE                                         96-MSE    

Chain E from PDB  Type:PROTEIN  Length:107
 aligned with Q81XF6_BACAN | Q81XF6 from UniProtKB/TrEMBL  Length:105

    Alignment length:107
                               1                                                                                                       
                               |     7        17        27        37        47        57        67        77        87        97       
         Q81XF6_BACAN     - ---MSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIR 104
               SCOP domains d3lnoe_ E: automated matches                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh..............eeeeee.....eeeee........hhhhhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 3lno E  -2 SNAmSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITmTmTSIGCPmAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERmSRmAKIALGIR 104
                               |     7        17        27        37        47 |      57        67        77        87     |  97       
                               1-MSE                                        47-MSE   56-MSE                               93-MSE       
                                                                              49-MSE                                         96-MSE    

Chain F from PDB  Type:PROTEIN  Length:106
 aligned with Q81XF6_BACAN | Q81XF6 from UniProtKB/TrEMBL  Length:105

    Alignment length:106
                             1                                                                                                        
                             |       9        19        29        39        49        59        69        79        89        99      
         Q81XF6_BACAN     - -MSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITMTMTSIGCPMAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERMSRMAKIALGIRD 105
               SCOP domains d3lnof_ F: automated matches                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------DUF59-3lnoF01 F:7-80                                                      ------------------------- Pfam domains (1)
           Pfam domains (2) -------DUF59-3lnoF02 F:7-80                                                      ------------------------- Pfam domains (2)
           Pfam domains (3) -------DUF59-3lnoF03 F:7-80                                                      ------------------------- Pfam domains (3)
           Pfam domains (4) -------DUF59-3lnoF04 F:7-80                                                      ------------------------- Pfam domains (4)
           Pfam domains (5) -------DUF59-3lnoF05 F:7-80                                                      ------------------------- Pfam domains (5)
           Pfam domains (6) -------DUF59-3lnoF06 F:7-80                                                      ------------------------- Pfam domains (6)
         Sec.struct. author hhhhhhhhhhhhhhhhhh..............eeeeee.....eeeee........hhhhhhhhhhhhhhhhh.....eeeee......hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 3lno F   0 AmSQEAFENKLYANLEAVIDPELGVDIVNLGLVYDVTADENNNAVITmTmTSIGCPmAGQIVSDVKKVLSTNVPEVNEIEVNVVWNPPWSKERmSRmAKIALGIRD 105
                             |       9        19        29        39       |49      | 59        69        79        89   |  | 99      
                             1-MSE                                        47-MSE   56-MSE                               93-MSE        
                                                                            49-MSE                                         96-MSE     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3LNO)

(-) Pfam Domains  (1, 6)

Asymmetric Unit
(-)
Clan: NifU (7)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (Q81XF6_BACAN | Q81XF6)
molecular function
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3lno)
 
  Cis Peptide Bonds
    Asn A:85 - Pro A:86   [ RasMol ]  
    Asn B:85 - Pro B:86   [ RasMol ]  
    Asn C:85 - Pro C:86   [ RasMol ]  
    Asn D:85 - Pro D:86   [ RasMol ]  
    Asn E:85 - Pro E:86   [ RasMol ]  
    Asn F:85 - Pro F:86   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3lno
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q81XF6_BACAN | Q81XF6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q81XF6_BACAN | Q81XF6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3LNO)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3LNO)