3LNC - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF GUANYLATE KINASE FROM ANAPLASMA PHAGOCYTOPHILUM

Authors :   Seattle Structural Genomics Center For Infectious Disease (Ssgcid)

Date :   02 Feb 10 (Deposition) - 16 Feb 10 (Release) - 16 Feb 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.95

Chains :   Asym./Biol. Unit : A,B

Keywords :   Als Collaborative Crystallography, Emerald Biostructures, Guanylate Kinase, Atp-Binding, Cytoplasm, Kinase, Nucleotide-Binding, Transferase, Structural Genomics, Seattle Structural Genomics Center For Infectious Disease, Ssgcid (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Abendroth, B. Sankaran, D. Davies, B. Staker
Crystal Structure Of Guanylate Kinase From Anaplasma Phagocytophilum
To Be Published
PubMed: search

Molecule 1 - GUANYLATE KINASE
	Chains	:	A, B
	EC Number	:	2.7.4.8
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	AVA0421
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	GMK, APH_0170
	Organism Scientific	:	ANAPLASMA PHAGOCYTOPHILUM
	Organism Taxid	:	212042
	Strain	:	HZ
	Synonym	:	GMP KINASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	5GP	2	Ligand/Ion	GUANOSINE-5'-MONOPHOSPHATE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:39 , ARG A:43 , ARG A:46 , TYR A:55 , GLU A:74 , ALA A:76 , VAL A:78 , TYR A:83 , GLY A:84 , VAL A:85 , VAL A:103 , ILE A:104 , ASP A:105 , GLY A:108 , HOH A:275 , HOH A:317	BINDING SITE FOR RESIDUE 5GP A 300
2	AC2	SOFTWARE	SER B:15 , SER B:39 , ARG B:43 , ARG B:46 , TYR B:55 , GLU B:74 , ALA B:76 , VAL B:78 , TYR B:83 , GLY B:84 , VAL B:85 , VAL B:103 , ILE B:104 , ASP B:105 , GLY B:108 , HOH B:219 , HOH B:234 , HOH B:286	BINDING SITE FOR RESIDUE 5GP B 300

(no "SS Bond" information available for 3LNC)

(no "Cis Peptide Bond" information available for 3LNC)

(no "SAP(SNP)/Variant" information available for 3LNC)

Asymmetric/Biological Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GUANYLATE_KINASE_2	PS50052	Guanylate kinase-like domain profile.	KGUA_ANAPZ	6-186	2	A:6-186 B:6-186
2	GUANYLATE_KINASE_1	PS00856	Guanylate kinase-like signature.	KGUA_ANAPZ	41-58	2	A:41-58 B:41-58

(no "Exon" information available for 3LNC)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:188
 aligned with KGUA_ANAPZ | Q2GLF7 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:210
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
           KGUA_ANAPZ     1 MLKSVGVILVLSSPSGCGKTTVANKLLEKQKNNIVKSVSVTTRAARKGEKEGKDYYFVDREEFLRLCSNGEIIEHAEVFGNFYGVPRKNLEDNVDKGVSTLLVIDWQGAFKFMEMMREHVVSIFIMPPSMEELRRRLCGRRADDSEVVEARLKGAAFEISHCEAYDYVIVNEDIEETADRISNILRAEQMKTCRQVGLRELLESRFPIED 210
               SCOP domains d3lnca_ A: autom    ated mat    ches                                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee...eeeee....----hhhhhhhh----.eee...ee..............ee.hhhhhhhhhhh..eeeeeee..eeeeee..hhhhhhhhh.eeeee.hhhhhhhhhhhh...eeeeeee..hhhhhhhh--------------hhhhhhhhhhhhhhh.eeee..hhhhhhhhhhhhhhhhhhhhh.eehhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -----GUANYLATE_KINASE_2  PDB: A:6-186 UniProt: 6-186                                                                                                                                      ------------------------ PROSITE (1)
                PROSITE (2) ----------------------------------------GUANYLATE_KINASE_1-------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3lnc A   1 MLKSVGVILVLSSPSG----TVANKLLE----NIVKSVSVTTRAARKGEKEGKDYYFVDREEFLRLCSNGEIIEHAEVFGNFYGVPRKNLEDNVDKGVSTLLVIDWQGAFKFMEMMREHVVSIFIMPPSMEELRRR--------------RLKGAAFEISHCEAYDYVIVNEDIEETADRISNILRAEQMKTCRQVGLRELLESRFPIED 210
                                    10     |   -|      | -  |     40        50        60        70        80        90       100       110       120       130     |   -         -|      160       170       180       190       200       210
                                          16   21     28   33                                                                                                    136            151

Chain B from PDB  Type:PROTEIN  Length:188
 aligned with KGUA_ANAPZ | Q2GLF7 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:210
                             1                                                                                                                                                                                                                
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209
           KGUA_ANAPZ     - -MLKSVGVILVLSSPSGCGKTTVANKLLEKQKNNIVKSVSVTTRAARKGEKEGKDYYFVDREEFLRLCSNGEIIEHAEVFGNFYGVPRKNLEDNVDKGVSTLLVIDWQGAFKFMEMMREHVVSIFIMPPSMEELRRRLCGRRADDSEVVEARLKGAAFEISHCEAYDYVIVNEDIEETADRISNILRAEQMKTCRQVGLRELLESRFPIE 209
               SCOP domains d3lncb_ B: autom     ated mat    ches                                                                                                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) ------Guanylate_     kin-3lnc    B01 B:6-188                                                                                                                                                 --------------------- Pfam domains (1)
           Pfam domains (2) ------Guanylate_     kin-3lnc    B02 B:6-188                                                                                                                                                 --------------------- Pfam domains (2)
         Sec.struct. author ........eeeee...-----hhhhhhhh----.eee...ee..............ee.hhhhhhhhhhh..eeeeeee..eeeeee..hhhhhhhhh.eeeee.hhhhhhhhhhhh...eeeeeee..hhhhhhh.-------------hhhhhhhhhhhhhhhh.eeee..hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ------GUANYLATE_KINASE_2  PDB: B:6-186 UniProt: 6-186                                                                                                                                      ----------------------- PROSITE (1)
                PROSITE (2) -----------------------------------------GUANYLATE_KINASE_1------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3lnc B   0 SMLKSVGVILVLSSPS-----TVANKLLE----NIVKSVSVTTRAARKGEKEGKDYYFVDREEFLRLCSNGEIIEHAEVFGNFYGVPRKNLEDNVDKGVSTLLVIDWQGAFKFMEMMREHVVSIFIMPPSMEELRRR-------------ARLKGAAFEISHCEAYDYVIVNEDIEETADRISNILRAEQMKTCRQVGLRELLESRFPIE 209
                                     9     |   - |      |-   |    39        49        59        69        79        89        99       109       119       129      |  -         -|      159       169       179       189       199       209
                                          15    21     28   33                                                                                                    136           150

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: P-loop containing nucleoside triphosphate hydrolases (2083)

Superfamily: P-loop containing nucleoside triphosphate hydrolases (2083)

Family: automated matches (303)

Protein domain: automated matches (303)

Anaplasma phagocytophilum [TaxId: 212042] (1)

1a	d3lnca_	A:
1b	d3lncb_	B:

(no "CATH Domain" information available for 3LNC)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: P-loop_NTPase (1112)

Family: Guanylate_kin (23)

Anaplasma phagocytophilum (strain HZ) (1)

1a	Guanylate_kin-3lncB01	B:6-188
1b	Guanylate_kin-3lncB02	B:6-188

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (KGUA_ANAPZ | Q2GLF7)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0004385	guanylate kinase activity	Catalysis of the reaction: ATP + GMP = ADP + GDP.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0046710	GDP metabolic process	The chemical reactions and pathways involving GDP, guanosine 5'-diphosphate.
	GO:0046037	GMP metabolic process	The chemical reactions and pathways involving GMP, guanosine monophosphate.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0006163	purine nucleotide metabolic process	The chemical reactions and pathways involving a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		5GP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3lnc)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3lnc
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	KGUA_ANAPZ \| Q2GLF7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.4.8
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	KGUA_ANAPZ \| Q2GLF7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 3LNC)

(no "Related Entries Specified in the PDB File" available for 3LNC)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File