Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SMU.1228C
 
Authors :  X. -X. Fan, K. -T. Wang, X. -D. Su
Date :  29 Dec 09  (Deposition) - 29 Dec 10  (Release) - 29 Dec 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Glutamine Amidotransferase, Streptococcus Mutans, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  X. -X. Fan, K. -T. Wang, X. -D. Su
Crystal Structure Of Smu. 1228C
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PUTATIVE UNCHARACTERIZED PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28A
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: SMU_1228C
    Organism Scientific: STREPTOCOCCUS MUTANS
    Organism Taxid: 210007
    Strain: UA159
    Synonym: GLUTAMINE AMIDOTRANSFERASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3L7N)

(-) Sites  (0, 0)

(no "Site" information available for 3L7N)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3L7N)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3L7N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3L7N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3L7N)

(-) Exons   (0, 0)

(no "Exon" information available for 3L7N)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:234
 aligned with Q8DTU5_STRMU | Q8DTU5 from UniProtKB/TrEMBL  Length:236

    Alignment length:234
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230    
         Q8DTU5_STRMU     1 MRIHFILHETFEAPGAYLAWAALRGHDVSMTKVYRYEKLPKDIDDFDMLILMGGPQSPSSTKKEFPYYDAQAEVKLIQKAAKSEKIIVGVCLGAQLMGVAYGADYLHSPKKEIGNYLISLTEAGKMDSYLSDFSDDLLVGHWHGDMPGLPDKAQVLAISQGCPRQIIKFGPKQYAFQCHLEFTPELVAALIAQEDDLDTQSQTETYVQTAEEMQTFDYSSMNQALYSFLDRLTE 234
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ----------------GATase-3l7nA01 A:17-194                                                                                                                                                           ---------------------------------------- Pfam domains
         Sec.struct. author .eeeeee......hhhhhhhhhhh..eeeeee.hhh.....hhhhh.eeee.................hhhhhhhhhhhhhhh..eeeeehhhhhhhhhhh....eeeeeeeeeeeeeee..hhhhhhhhh....eeeeeeeeeee.......eeeee.......eeeee..eeee......hhhhhhhhhhhh.hhhhhhhhh....hhhhhhh..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3l7n A   1 MRIHFILHETFEAPGAYLAWAALRGHDVSMTKVYRYEKLPKDIDDFDMLILMGGPQSPSSTKKEFPYYDAQAEVKLIQKAAKSEKIIVGVCLGAQLMGVAYGADYLHSPKKEIGNYLISLTEAGKMDSYLSDFSDDLLVGHWHGDMPGLPDKAQVLAISQGCPRQIIKFGPKQYAFQCHLEFTPELVAALIAQEDDLDTQSQTETYVQTAEEMQTFDYSSMNQALYSFLDRLTE 234
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3L7N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3L7N)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: Glutaminase_I (73)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3L7N)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3l7n)
 
  Sites
(no "Sites" information available for 3l7n)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3l7n)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3l7n
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8DTU5_STRMU | Q8DTU5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8DTU5_STRMU | Q8DTU5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3L7N)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3L7N)