Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  HUMAN MESOTRYPSIN COMPLEXED WITH AMYLOID PRECURSOR PROTEIN INHIBITOR VARIANT (APPIR15K)
 
Authors :  M. A. Salameh, A. S. Soares, E. S. Radisky
Date :  17 Dec 09  (Deposition) - 22 Sep 10  (Release) - 12 Jan 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.38
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,E  (1x)
Biol. Unit 2:  B,F  (1x)
Biol. Unit 3:  C,G  (1x)
Biol. Unit 4:  D,H  (1x)
Keywords :  Human Mesotrypsin, Canonical Inhibitor, Alzheimer'S Amyloid Precursor Protein Inhibitor, Appi, Appi-R15K, Hydrolase-Cell Adhesion Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. A. Salameh, A. S. Soares, D. Navaneetham, D. Sinha, P. N. Walsh, E. S. Radisky
Determinants Of Affinity And Proteolytic Stability In Interactions Of Kunitz Family Protease Inhibitors With Mesotrypsin.
J. Biol. Chem. V. 285 36884 2010
PubMed-ID: 20861008  |  Reference-DOI: 10.1074/JBC.M110.171348

(-) Compounds

Molecule 1 - PRSS3 PROTEIN
    ChainsA, B, C, D
    EC Number3.4.21.4
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentUNP RESIDUES 28-251
    GenePRSS3
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    StrainBL21(DE3)
    SynonymMESOTRYPSIN
 
Molecule 2 - PROTEIN APP
    ChainsE, F, G, H
    EngineeredYES
    Expression SystemPICHIA PASTORIS
    Expression System Taxid4922
    FragmentUNP RESIDUES 211-267
    GeneAPP
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymALZHEIMER'S AMYLOID BETA-PROTEIN PRECURSOR

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABCDEFGH
Biological Unit 1 (1x)A   E   
Biological Unit 2 (1x) B   F  
Biological Unit 3 (1x)  C   G 
Biological Unit 4 (1x)   D   H

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 17)

Asymmetric Unit (2, 17)
No.NameCountTypeFull Name
1CA4Ligand/IonCALCIUM ION
2FMT13Ligand/IonFORMIC ACID
Biological Unit 1 (1, 7)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2FMT7Ligand/IonFORMIC ACID
Biological Unit 2 (1, 5)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2FMT5Ligand/IonFORMIC ACID
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2FMT1Ligand/IonFORMIC ACID
Biological Unit 4 (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2FMT-1Ligand/IonFORMIC ACID

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWARELEU A:163 , HOH A:300BINDING SITE FOR RESIDUE FMT A 1
02AC2SOFTWAREARG A:66 , ILE A:73 , HOH A:269 , HOH A:341BINDING SITE FOR RESIDUE FMT A 2
03AC3SOFTWAREPRO B:129 , LEU B:163BINDING SITE FOR RESIDUE FMT B 3
04AC4SOFTWAREASN A:233 , TYR A:234 , VAL A:235 , ASP A:236 , TRP A:237BINDING SITE FOR RESIDUE FMT A 4
05AC5SOFTWAREALA A:221 , TRP A:221A , LYS A:222 , HOH A:327BINDING SITE FOR RESIDUE FMT A 247
06AC6SOFTWARESER A:119 , THR A:120 , HOH A:205 , HOH A:301 , SER C:122 , GLY C:203BINDING SITE FOR RESIDUE FMT A 248
07AC7SOFTWAREPRO C:129 , LYS C:230BINDING SITE FOR RESIDUE FMT C 247
08AC8SOFTWARESER B:171 , ASN B:223BINDING SITE FOR RESIDUE FMT B 10
09AC9SOFTWAREHIS B:91 , LYS B:93 , GLY C:174BINDING SITE FOR RESIDUE FMT B 11
10BC1SOFTWARETHR A:164 , THR B:164BINDING SITE FOR RESIDUE FMT B 12
11BC2SOFTWAREGLY A:219BINDING SITE FOR RESIDUE FMT A 13
12BC3SOFTWAREGLU B:70 , ASN B:72 , VAL B:75 , GLU B:77 , GLU B:80BINDING SITE FOR RESIDUE CA B 1
13BC4SOFTWAREGLU A:70 , ASN A:72 , VAL A:75 , GLU A:77 , GLU A:80 , HOH A:269BINDING SITE FOR RESIDUE CA A 250
14BC5SOFTWAREGLU C:70 , ASN C:72 , VAL C:75 , GLU C:77 , GLU C:80 , HOH C:289BINDING SITE FOR RESIDUE CA C 3
15BC6SOFTWAREGLU D:70 , ASN D:72 , VAL D:75 , GLU D:80 , HOH D:267BINDING SITE FOR RESIDUE CA D 4

(-) SS Bonds  (32, 32)

Asymmetric Unit
No.Residues
1A:22 -A:157
2A:42 -A:58
3A:136 -A:201
4A:168 -A:182
5A:191 -A:220
6B:22 -B:157
7B:42 -B:58
8B:136 -B:201
9B:168 -B:182
10B:191 -B:220
11C:22 -C:157
12C:42 -C:58
13C:136 -C:201
14C:168 -C:182
15C:191 -C:220
16D:22 -D:157
17D:42 -D:58
18D:136 -D:201
19D:168 -D:182
20D:191 -D:220
21E:5 -E:55
22E:14 -E:38
23E:30 -E:51
24F:5 -F:55
25F:14 -F:38
26F:30 -F:51
27G:5 -G:55
28G:14 -G:38
29G:30 -G:51
30H:5 -H:55
31H:14 -H:38
32H:30 -H:51

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Gly C:38 -Ser C:39
2Leu D:76 -Glu D:77
3Gly D:78 -Asn D:79
4Ala F:58 -Ile F:59

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 16)

Asymmetric Unit (4, 16)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_067459A174VTRY3_HUMANPolymorphism11547028A/B/C/DA112V
2UniProtVAR_046794T188ATRY3_HUMANPolymorphism855581A/B/C/DA127A
3UniProtVAR_059788T224STRY3_HUMANPolymorphism1063273A/B/C/DT164S
4UniProtVAR_046795Y232CTRY3_HUMANPolymorphism1048379A/B/C/DY172C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_067459A174VTRY3_HUMANPolymorphism11547028AA112V
2UniProtVAR_046794T188ATRY3_HUMANPolymorphism855581AA127A
3UniProtVAR_059788T224STRY3_HUMANPolymorphism1063273AT164S
4UniProtVAR_046795Y232CTRY3_HUMANPolymorphism1048379AY172C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_067459A174VTRY3_HUMANPolymorphism11547028BA112V
2UniProtVAR_046794T188ATRY3_HUMANPolymorphism855581BA127A
3UniProtVAR_059788T224STRY3_HUMANPolymorphism1063273BT164S
4UniProtVAR_046795Y232CTRY3_HUMANPolymorphism1048379BY172C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_067459A174VTRY3_HUMANPolymorphism11547028CA112V
2UniProtVAR_046794T188ATRY3_HUMANPolymorphism855581CA127A
3UniProtVAR_059788T224STRY3_HUMANPolymorphism1063273CT164S
4UniProtVAR_046795Y232CTRY3_HUMANPolymorphism1048379CY172C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_067459A174VTRY3_HUMANPolymorphism11547028DA112V
2UniProtVAR_046794T188ATRY3_HUMANPolymorphism855581DA127A
3UniProtVAR_059788T224STRY3_HUMANPolymorphism1063273DT164S
4UniProtVAR_046795Y232CTRY3_HUMANPolymorphism1048379DY172C

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 8)

Asymmetric Unit (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.TRY3_HUMAN81-301
 
 
 
  4A:16-243
B:16-243
C:16-243
D:16-243
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.TRY3_HUMAN116-121
 
 
 
  4A:53-58
B:53-58
C:53-58
D:53-58
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.TRY3_HUMAN81-301
 
 
 
  1A:16-243
-
-
-
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.TRY3_HUMAN116-121
 
 
 
  1A:53-58
-
-
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.TRY3_HUMAN81-301
 
 
 
  1-
B:16-243
-
-
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.TRY3_HUMAN116-121
 
 
 
  1-
B:53-58
-
-
Biological Unit 3 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.TRY3_HUMAN81-301
 
 
 
  1-
-
C:16-243
-
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.TRY3_HUMAN116-121
 
 
 
  1-
-
C:53-58
-
Biological Unit 4 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TRYPSIN_DOMPS50240 Serine proteases, trypsin domain profile.TRY3_HUMAN81-301
 
 
 
  1-
-
-
D:16-243
2TRYPSIN_HISPS00134 Serine proteases, trypsin family, histidine active site.TRY3_HUMAN116-121
 
 
 
  1-
-
-
D:53-58

(-) Exons   (4, 16)

Asymmetric Unit (4, 16)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003610051aENSE00001822892chr9:33750515-33750725211TRY3_HUMAN1-71710--
1.5ENST000003610055ENSE00001682759chr9:33796641-33796800160TRY3_HUMAN71-124544A:16-61 (gaps)
B:16-61 (gaps)
C:16-61 (gaps)
D:16-61 (gaps)
46
46
46
46
1.6ENST000003610056ENSE00001749737chr9:33797827-33798080254TRY3_HUMAN124-209864A:61-149 (gaps)
B:61-149 (gaps)
C:61-149 (gaps)
D:61-149 (gaps)
89
89
89
89
1.7bENST000003610057bENSE00001625216chr9:33798484-33798620137TRY3_HUMAN209-254464A:149-192
B:149-192
C:149-192
D:149-192
46
46
46
46
1.8cENST000003610058cENSE00001859079chr9:33799026-33799229204TRY3_HUMAN255-304504A:193-246 (gaps)
B:193-246 (gaps)
C:193-246 (gaps)
D:193-246 (gaps)
55
55
55
55

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:224
 aligned with Q8N2U3_HUMAN | Q8N2U3 from UniProtKB/TrEMBL  Length:251

    Alignment length:224
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247    
        Q8N2U3_HUMAN     28 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  251
               SCOP domains d3l3ta_ A: Trypsin(ogen)                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------V-------------A-----------------------------------S-------C------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3l3t A   16 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  246
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180    | 188A       198     ||212    || 222       232       242    
                                             34|                            67|                                                     125|  ||                                                 184A 188A             204|     217|  |                         
                                              37                             69                                                      127  ||                                                                        209      219  |                         
                                                                                                                                        130|                                                                                   221A                         
                                                                                                                                         132                                                                                                                

Chain A from PDB  Type:PROTEIN  Length:224
 aligned with TRY3_HUMAN | P35030 from UniProtKB/Swiss-Prot  Length:304

    Alignment length:224
                                    90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300    
          TRY3_HUMAN     81 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  304
               SCOP domains d3l3ta_ A: Trypsin(ogen)                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------V-------------A-----------------------------------S-------C------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: A:16-243 UniProt: 81-301                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.5  PDB: A:16-61 (gaps) [INCOMPLETE]  ------------------------------------------------------------------------------------Exon 1.7b  PDB: A:149-192 UniProt: 209-254    Exon 1.8c  PDB: A:193-246 (gaps) UniProt: 255-304  Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.6  PDB: A:61-149 (gaps) UniProt: 124-209                                       ----------------------------------------------------------------------------------------------- Transcript 1 (2)
                3l3t A   16 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  246
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180    | 188A       198     ||212    || 222       232       242    
                                             34|                            67|                                                     125|  ||                                                 184A 188A             204|     217|  |                         
                                              37                             69                                                      127  ||                                                                        209      219  |                         
                                                                                                                                        130|                                                                                   221A                         
                                                                                                                                         132                                                                                                                

Chain B from PDB  Type:PROTEIN  Length:224
 aligned with Q8N2U3_HUMAN | Q8N2U3 from UniProtKB/TrEMBL  Length:251

    Alignment length:224
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247    
        Q8N2U3_HUMAN     28 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  251
               SCOP domains d3l3tb_ B: Trypsin(ogen)                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eee....eeeeeee..........eeeee...hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------V-------------A-----------------------------------S-------C------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3l3t B   16 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  246
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180    | 188A       198     ||212    || 222       232       242    
                                             34|                            67|                                                     125|  ||                                                 184A 188A             204|     217|  |                         
                                              37                             69                                                      127  ||                                                                        209      219  |                         
                                                                                                                                        130|                                                                                   221A                         
                                                                                                                                         132                                                                                                                

Chain B from PDB  Type:PROTEIN  Length:224
 aligned with TRY3_HUMAN | P35030 from UniProtKB/Swiss-Prot  Length:304

    Alignment length:224
                                    90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300    
          TRY3_HUMAN     81 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  304
               SCOP domains d3l3tb_ B: Trypsin(ogen)                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eee....eeeeeee..........eeeee...hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------V-------------A-----------------------------------S-------C------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: B:16-243 UniProt: 81-301                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.5  PDB: B:16-61 (gaps) [INCOMPLETE]  ------------------------------------------------------------------------------------Exon 1.7b  PDB: B:149-192 UniProt: 209-254    Exon 1.8c  PDB: B:193-246 (gaps) UniProt: 255-304  Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.6  PDB: B:61-149 (gaps) UniProt: 124-209                                       ----------------------------------------------------------------------------------------------- Transcript 1 (2)
                3l3t B   16 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  246
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180    | 188A       198     ||212    || 222       232       242    
                                             34|                            67|                                                     125|  ||                                                 184A 188A             204|     217|  |                         
                                              37                             69                                                      127  ||                                                                        209      219  |                         
                                                                                                                                        130|                                                                                   221A                         
                                                                                                                                         132                                                                                                                

Chain C from PDB  Type:PROTEIN  Length:224
 aligned with Q8N2U3_HUMAN | Q8N2U3 from UniProtKB/TrEMBL  Length:251

    Alignment length:224
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247    
        Q8N2U3_HUMAN     28 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  251
               SCOP domains d3l3tc_ C: Trypsin(ogen)                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeee....eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------V-------------A-----------------------------------S-------C------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3l3t C   16 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  246
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180    | 188A       198     ||212    || 222       232       242    
                                             34|                            67|                                                     125|  ||                                                 184A 188A             204|     217|  |                         
                                              37                             69                                                      127  ||                                                                        209      219  |                         
                                                                                                                                        130|                                                                                   221A                         
                                                                                                                                         132                                                                                                                

Chain C from PDB  Type:PROTEIN  Length:224
 aligned with TRY3_HUMAN | P35030 from UniProtKB/Swiss-Prot  Length:304

    Alignment length:224
                                    90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300    
          TRY3_HUMAN     81 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  304
               SCOP domains d3l3tc_ C: Trypsin(ogen)                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee........eeeee...eeeeeee....eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------V-------------A-----------------------------------S-------C------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: C:16-243 UniProt: 81-301                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.5  PDB: C:16-61 (gaps) [INCOMPLETE]  ------------------------------------------------------------------------------------Exon 1.7b  PDB: C:149-192 UniProt: 209-254    Exon 1.8c  PDB: C:193-246 (gaps) UniProt: 255-304  Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.6  PDB: C:61-149 (gaps) UniProt: 124-209                                       ----------------------------------------------------------------------------------------------- Transcript 1 (2)
                3l3t C   16 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  246
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180    | 188A       198     ||212    || 222       232       242    
                                             34|                            67|                                                     125|  ||                                                 184A 188A             204|     217|  |                         
                                              37                             69                                                      127  ||                                                                        209      219  |                         
                                                                                                                                        130|                                                                                   221A                         
                                                                                                                                         132                                                                                                                

Chain D from PDB  Type:PROTEIN  Length:224
 aligned with Q8N2U3_HUMAN | Q8N2U3 from UniProtKB/TrEMBL  Length:251

    Alignment length:224
                                    37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247    
        Q8N2U3_HUMAN     28 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  251
               SCOP domains d3l3td_ D: Trypsin(ogen)                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Trypsin-3l3tD01 D:16-238                                                                                                                                                                                                -------- Pfam domains (1)
           Pfam domains (2) Trypsin-3l3tD02 D:16-238                                                                                                                                                                                                -------- Pfam domains (2)
           Pfam domains (3) Trypsin-3l3tD03 D:16-238                                                                                                                                                                                                -------- Pfam domains (3)
           Pfam domains (4) Trypsin-3l3tD04 D:16-238                                                                                                                                                                                                -------- Pfam domains (4)
         Sec.struct. author ....ee........eeeee...eeeeeee....eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------V-------------A-----------------------------------S-------C------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3l3t D   16 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  246
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180    | 188A       198     ||212    || 222       232       242    
                                             34|                            67|                                                     125|  ||                                                 184A 188A             204|     217|  |                         
                                              37                             69                                                      127  ||                                                                        209      219  |                         
                                                                                                                                        130|                                                                                   221A                         
                                                                                                                                         132                                                                                                                

Chain D from PDB  Type:PROTEIN  Length:224
 aligned with TRY3_HUMAN | P35030 from UniProtKB/Swiss-Prot  Length:304

    Alignment length:224
                                    90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300    
          TRY3_HUMAN     81 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  304
               SCOP domains d3l3td_ D: Trypsin(ogen)                                                                                                                                                                                                         SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Trypsin-3l3tD01 D:16-238                                                                                                                                                                                                -------- Pfam domains (1)
           Pfam domains (2) Trypsin-3l3tD02 D:16-238                                                                                                                                                                                                -------- Pfam domains (2)
           Pfam domains (3) Trypsin-3l3tD03 D:16-238                                                                                                                                                                                                -------- Pfam domains (3)
           Pfam domains (4) Trypsin-3l3tD04 D:16-238                                                                                                                                                                                                -------- Pfam domains (4)
         Sec.struct. author ....ee........eeeee...eeeeeee....eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------V-------------A-----------------------------------S-------C------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) TRYPSIN_DOM  PDB: D:16-243 UniProt: 81-301                                                                                                                                                                                   --- PROSITE (1)
                PROSITE (2) -----------------------------------TRYPSI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.5  PDB: D:16-61 (gaps) [INCOMPLETE]  ------------------------------------------------------------------------------------Exon 1.7b  PDB: D:149-192 UniProt: 209-254    Exon 1.8c  PDB: D:193-246 (gaps) UniProt: 255-304  Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------Exon 1.6  PDB: D:61-149 (gaps) UniProt: 124-209                                       ----------------------------------------------------------------------------------------------- Transcript 1 (2)
                3l3t D   16 IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS  246
                                    25        37        47        57        67|       78        88        98       108       118      |129||     140       150       160       170       180    | 188A       198     ||212    || 222       232       242    
                                             34|                            67|                                                     125|  ||                                                 184A 188A             204|     217|  |                         
                                              37                             69                                                      127  ||                                                                        209      219  |                         
                                                                                                                                        130|                                                                                   221A                         
                                                                                                                                         132                                                                                                                

Chain E from PDB  Type:PROTEIN  Length:57
                                                                                          
               SCOP domains d3l3te_ E: automated matches                              SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..........eeeeeee....eeeeeee...........hhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------- Transcript
                3l3t E    3 EVCSEQAETGPCKAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAI   59
                                    12        22        32        42        52       

Chain F from PDB  Type:PROTEIN  Length:57
                                                                                          
               SCOP domains d3l3tf_ F: automated matches                              SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeeee....eeeeeee...........hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------- Transcript
                3l3t F    3 EVCSEQAETGPCKAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAI   59
                                    12        22        32        42        52       

Chain G from PDB  Type:PROTEIN  Length:57
                                                                                          
               SCOP domains d3l3tg_ G: automated matches                              SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhh..........eeeeeee....eeeeeee...........hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------- Transcript
                3l3t G    3 EVCSEQAETGPCKAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAI   59
                                    12        22        32        42        52       

Chain H from PDB  Type:PROTEIN  Length:57
                                                                                          
               SCOP domains d3l3th_ H: automated matches                              SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eeeeeee....eeeeeee...........hhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------- Transcript
                3l3t H    3 EVCSEQAETGPCKAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAI   59
                                    12        22        32        42        52       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3L3T)

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (15, 17)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (TRY3_HUMAN | P35030)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0009235    cobalamin metabolic process    The chemical reactions and pathways involving cobalamin (vitamin B12), a water-soluble vitamin characterized by possession of a corrin nucleus containing a cobalt atom.
    GO:0007586    digestion    The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
    GO:0043542    endothelial cell migration    The orderly movement of an endothelial cell into the extracellular matrix to form an endothelium.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0031638    zymogen activation    The proteolytic processing of an inactive enzyme to an active form.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain A,B,C,D   (Q8N2U3_HUMAN | Q8N2U3)
molecular function
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FMT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
    BC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala F:58 - Ile F:59   [ RasMol ]  
    Gly C:38 - Ser C:39   [ RasMol ]  
    Gly D:78 - Asn D:79   [ RasMol ]  
    Leu D:76 - Glu D:77   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3l3t
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8N2U3_HUMAN | Q8N2U3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TRY3_HUMAN | P35030
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.4
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8N2U3_HUMAN | Q8N2U3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRY3_HUMAN | P35030
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q8N2U3_HUMAN | Q8N2U33p92 3p95 4dg4 5jbt
        TRY3_HUMAN | P350301h4w 2r9p 3l33 3p92 3p95 4dg4 4u30 4u32 5c67 5jbt 5tp0

(-) Related Entries Specified in the PDB File

1zjd KUNITZ PROTEASE INHIBITOR DOMAIN
2r9p HUMAN MESOTRYPSIN