Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF S. CEREVISIAE STN1 C-TERMINAL
 
Authors :  J. Sun, E. Y. Yu, Y. T. Yang, L. A. Confer, S. H. Sun, K. Wan, N. F. Lue, M. Lei
Date :  26 Oct 09  (Deposition) - 22 Dec 09  (Release) - 29 Dec 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Butterfly Wing-Shaped, Helix, Chromosomal Protein, Phosphoprotein, Telomere (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Sun, E. Y. Yu, Y. Yang, L. A. Confer, S. H. Sun, K. Wan, N. F. Lue, M. Lei
Stn1-Ten1 Is An Rpa2-Rpa3-Like Complex At Telomeres.
Genes Dev. V. 23 2900 2009
PubMed-ID: 20008938  |  Reference-DOI: 10.1101/GAD.1851909
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN STN1
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28B
    Expression System Strain: BL21
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: STN1, YDR082W, D4456, YD8554.15
    Organism Common: YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3KEY)

(-) Sites  (0, 0)

(no "Site" information available for 3KEY)

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:420 -A:420

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3KEY)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3KEY)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3KEY)

(-) Exons   (0, 0)

(no "Exon" information available for 3KEY)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:175
 aligned with STN1_YEAST | P38960 from UniProtKB/Swiss-Prot  Length:494

    Alignment length:183
                                   321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491   
           STN1_YEAST   312 RTSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLDPKNGMEDQNSGILLHLEYAAAYS 494
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------Stn1_C-3keyA01 A:362-493                                                                                                            - Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhh...eeehhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh...eeee....eeehhhhhhhhhhhhhhhhhhhhh...eeeeehhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...eeeeeeee.--------..eeeeeeee..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3key A 312 RTSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLD--------NSGILLHLEYAAAYS 494
                                   321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491   
                                                                                                                                                                                         471      480
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3KEY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3KEY)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: Stn1_C] (2)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (STN1_YEAST | P38960)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043047    single-stranded telomeric DNA binding    Interacting selectively and non-covalently with single-stranded telomere-associated DNA.
biological process
    GO:0032211    negative regulation of telomere maintenance via telomerase    Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of telomeric repeats by telomerase.
    GO:0016233    telomere capping    A process in which telomeres are protected from degradation and fusion, thereby ensuring chromosome stability by protecting the ends from both degradation and from being recognized as damaged DNA. May be mediated by specific single- or double-stranded telomeric DNA binding proteins.
cellular component
    GO:1990879    CST complex    A complex formed by the association of Cdc13 (CTC1 in mammals) with Stn1 in yeast (OBFC1 in mammals) and Ten1 protein (also TEN1 in mammals) with single-stranded telomeric DNA. The CST complex plays a role in telomere protection.
    GO:0005694    chromosome    A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
    GO:0000781    chromosome, telomeric region    The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3key)
 
  Sites
(no "Sites" information available for 3key)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3key)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3key
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  STN1_YEAST | P38960
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  STN1_YEAST | P38960
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        STN1_YEAST | P38960: 3k10

(-) Related Entries Specified in the PDB File

3kf6 CRYSTAL STRUCTURE OF S. POMBE STN1-TEN1 COMPLEX
3kf8 CRYSTAL STRUCTURE OF C. TROPICALIS STN1-TEN1 COMPLEX