Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THIAMIN PYROPHOSPHOKINASE FROM GEOBACILLUS THERMODENITRIFICANS, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET GTR2
 
Authors :  A. Kuzin, M. Su, J. Seetharaman, J. Janjua, R. Xiao, D. J. Patel, C. Cicco D. Lee, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, J. L. Tong, Northeast Structural Genomics Consortium (Nesg)
Date :  15 Oct 09  (Deposition) - 09 Feb 10  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A (1x),B (1x)
Keywords :  Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Gtr2, Kinase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Kuzin, M. Su, J. Seetharaman, J. Janjua, R. Xiao, D. J. Patel, C. Ciccosanti, D. Lee, J. K. Everett, R. Nair, T. B. Acton, B. Rost, G. T. Montelione, J. F. Hunt, L. Tong
Northeast Structural Genomics Consortium Target Gtr2
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - THIAMIN PYROPHOSPHOKINASE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPET 21-23C
    Expression System StrainBL21(DE3)+ MAGIC
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneGTNG_1032
    Organism ScientificGEOBACILLUS THERMODENITRIFICANS
    Organism Taxid420246
    StrainNG80-2

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A (1x)B (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 20)

Asymmetric Unit (2, 20)
No.NameCountTypeFull Name
1CSO8Mod. Amino AcidS-HYDROXYCYSTEINE
2MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (2, 10)
No.NameCountTypeFull Name
1CSO4Mod. Amino AcidS-HYDROXYCYSTEINE
2MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3K94)

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:150 -A:214
2B:150 -B:214

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3K94)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3K94)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3K94)

(-) Exons   (0, 0)

(no "Exon" information available for 3K94)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:215
 aligned with A4IM54_GEOTN | A4IM54 from UniProtKB/TrEMBL  Length:215

    Alignment length:215
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210     
         A4IM54_GEOTN     1 MIIHIVGGGPRELLPDLRFYDGEDVCWVGVDRGTMTLLEAGFRPVRAFGDFDSLPAEDVVKLQQAFPDLDVWPAEKDKTDMEIALDWAVEQTARCIRLFGATGGRLDHLFGNVELLLKYADRPIEIVDRQNVLTVHLPGTYTVMYDARYCYVSYIPVSETVAEFTLTGFKYPLTNCHISRGSTLCISNELIQSSGTFSFSEGILMMIRSSDSSCL 215
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee...hhhhh.hhhhhh...eeeeee.hhhhhhhhhh....eee.hhhhhhhhhhhhhhhhh....ee......hhhhhhhhhhhh....eeeee.....hhhhhhhhhhhhhhh....eeeee..eeeeee..eeeeee......eeeeee...eeeeeeee........eeee..............eeeeee....eeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3k94 A   1 mIIHIVGGGPRELLPDLRFYDGEDVcWVGVDRGTmTLLEAGFRPVRAFGDFDSLPAEDVVKLQQAFPDLDVWPAEKDKTDmEIALDWAVEQTARcIRLFGATGGRLDHLFGNVELLLKYADRPIEIVDRQNVLTVHLPGTYTVmYDARYCYVSYIPVSETVAEFTLTGFKYPLTNcHISRGSTLcISNELIQSSGTFSFSEGILmmIRSSDSSCL 215
                            |       10        20     |  30    |   40        50        60        70        80|       90    |  100       110       120       130       140   |   150       160       170     | 180    |  190       200    || 210     
                            |                       26-CSO   35-MSE                                        81-MSE        95-CSO                                          144-MSE                         176-CSO  185-CSO             205-MSE      
                            1-MSE                                                                                                                                                                                                      206-MSE     

Chain B from PDB  Type:PROTEIN  Length:216
 aligned with A4IM54_GEOTN | A4IM54 from UniProtKB/TrEMBL  Length:215

    Alignment length:216
                                                                                                                                                                                                                                                215 
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210    | 
         A4IM54_GEOTN     1 MIIHIVGGGPRELLPDLRFYDGEDVCWVGVDRGTMTLLEAGFRPVRAFGDFDSLPAEDVVKLQQAFPDLDVWPAEKDKTDMEIALDWAVEQTARCIRLFGATGGRLDHLFGNVELLLKYADRPIEIVDRQNVLTVHLPGTYTVMYDARYCYVSYIPVSETVAEFTLTGFKYPLTNCHISRGSTLCISNELIQSSGTFSFSEGILMMIRSSDSSCL-   -
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee...hhhhh.hhhhhh...eeeeee.hhhhhhhhhh....eee.hhhhhhhhhhhhhhhhh....ee......hhhhhhhhhhh.....eeeee.....hhhhhhhhhhhhhhh....eeeee..eeeeee..eeeeee......eeeeee...eeeeeeee.....eeeeeee......eee.....eeeeee....eeeeee....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3k94 B   1 mIIHIVGGGPRELLPDLRFYDGEDVcWVGVDRGTmTLLEAGFRPVRAFGDFDSLPAEDVVKLQQAFPDLDVWPAEKDKTDmEIALDWAVEQTARcIRLFGATGGRLDHLFGNVELLLKYADRPIEIVDRQNVLTVHLPGTYTVmYDARYCYVSYIPVSETVAEFTLTGFKYPLTNcHISRGSTLcISNELIQSSGTFSFSEGILmmIRSSDSSCLL 216
                            |       10        20     |  30    |   40        50        60        70        80|       90    |  100       110       120       130       140   |   150       160       170     | 180    |  190       200    || 210      
                            1-MSE                   26-CSO   35-MSE                                        81-MSE        95-CSO                                          144-MSE                         176-CSO  185-CSO             205-MSE       
                                                                                                                                                                                                                                       206-MSE      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3K94)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3K94)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3K94)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (A4IM54_GEOTN | A4IM54)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0030975    thiamine binding    Interacting selectively and non-covalently with thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.
    GO:0004788    thiamine diphosphokinase activity    Catalysis of the reaction: ATP + thiamine = AMP + thiamine diphosphate.
biological process
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0009229    thiamine diphosphate biosynthetic process    The chemical reactions and pathways resulting in the formation of thiamine diphosphate, a derivative of thiamine (vitamin B1) which acts as a coenzyme in a range of processes including the Krebs cycle.
    GO:0006772    thiamine metabolic process    The chemical reactions and pathways involving thiamine (vitamin B1), a water soluble vitamin present in fresh vegetables and meats, especially liver.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CSO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3k94)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3k94)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3k94
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A4IM54_GEOTN | A4IM54
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A4IM54_GEOTN | A4IM54
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3K94)

(-) Related Entries Specified in the PDB File

3cq9 34% HOMOLOGY
gtr2