|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 8)
Asymmetric Unit (1, 8)
|
Sites (0, 0)| (no "Site" information available for 3IH3) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3IH3) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3IH3) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3IH3) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3IH3) |
Exons (0, 0)| (no "Exon" information available for 3IH3) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:202 aligned with Q9X0C0_THEMA | Q9X0C0 from UniProtKB/TrEMBL Length:200 Alignment length:202 1 | 8 18 28 38 48 58 68 78 88 98 108 118 128 138 148 158 168 178 188 198 Q9X0C0_THEMA - --MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK 200 SCOP domains d3ih3a1 A:-1-75 Transcriptional regulator TM1030 d3ih3a2 A:76-200 Transcriptional regulator TM1030 SCOP domains CATH domains 3ih3A01 A:-1-46 Homeodomain-like 3ih3A02 A:47-200 Tetracycline Repressor, domain 2 CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3ih3 A -1 GHmLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYmSVTEKLQKEFENFLmKNRNRDIFDFmERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLmWFFSGFEEVYLRTYQGKPELLKRDmNTLVEEVKVmLRILKKGmTK 200 | 8 18 28 38 48 |58 68 | 78 | 88 98 108 118 128 138 148 |158 168 178 | 188 | 198 | 56-MSE 71-MSE 82-MSE 155-MSE 180-MSE 190-MSE 198-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (2, 2)| Asymmetric Unit |
CATH Domains (2, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3IH3) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (Q9X0C0_THEMA | Q9X0C0)
|
||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|