|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3I2Z) |
(no "Site" information available for 3I2Z) |
(no "SS Bond" information available for 3I2Z) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 3I2Z) |
(no "PROSITE Motif" information available for 3I2Z) |
(no "Exon" information available for 3I2Z) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:71 aligned with Q7CQZ5_SALTY | Q7CQZ5 from UniProtKB/TrEMBL Length:69 Alignment length:71 1 | 8 18 28 38 48 58 68 Q7CQZ5_SALTY - --MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVTAL 69 SCOP domains d3i2za_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------- Transcript 3i2z A -1 SHMSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVTAL 69 8 18 28 38 48 58 68 Chain B from PDB Type:PROTEIN Length:67 aligned with Q7CQZ5_SALTY | Q7CQZ5 from UniProtKB/TrEMBL Length:69 Alignment length:67 12 22 32 42 52 62 Q7CQZ5_SALTY 3 KIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVTAL 69 SCOP domains d3i2zb_ B: automated matches SCOP domains CATH domains ------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 3i2z B 3 KIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVTAL 69 12 22 32 42 52 62
|
Asymmetric Unit |
(no "CATH Domain" information available for 3I2Z) |
(no "Pfam Domain" information available for 3I2Z) |
Asymmetric Unit(hide GO term definitions) Chain A,B (Q7CQZ5_SALTY | Q7CQZ5)
|
|
|
|
|
|
|