Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SAPORIN-L1 IN COMPLEX WITH THE DINUCLEOTIDE INHIBITOR, A TRANSITION STATE ANALOGUE
 
Authors :  M. Ho, M. B. Sturm, S. C. Almo, V. L. Schramm
Date :  20 May 09  (Deposition) - 08 Dec 09  (Release) - 21 Apr 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.29
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Transition State, Ribosome Inactivating Proteins, Rips, Hydrolase, Plant Defense, Protein Synthesis Inhibitor, Toxin, Hydrolase-Hydrolase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. C. Ho, M. B. Sturm, S. C. Almo, V. L. Schramm
Transition State Analogues In Structures Of Ricin And Saporin Ribosome-Inactivating Proteins.
Proc. Natl. Acad. Sci. Usa V. 106 20276 2009
PubMed-ID: 19920175  |  Reference-DOI: 10.1073/PNAS.0911606106

(-) Compounds

Molecule 1 - VACUOLAR SAPORIN
    ChainsA, B
    EC Number3.2.2.22
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism CommonCOMMON SOAPWORT
    Organism ScientificSAPONARIA OFFICINALIS
    Organism Taxid3572

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1DYN2Ligand/Ion5'-O-[(S)-{[(3R,4R)-1-[(4-AMINO-5H-PYRROLO[3,2-D]PYRIMIDIN-7-YL)METHYL]-4-({[(S)-HYDROXY(3-HYDROXYPROPOXY)PHOSPHORYL]OXY}METHYL)PYRROLIDIN-3-YL]OXY}(HYDROXY)PHOSPHORYL]-3'-O-[(R)-HYDROXY(4-HYDROXYBUTOXY)PHOSPHORYL]-2'-O-METHYLGUANOSINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1DYN1Ligand/Ion5'-O-[(S)-{[(3R,4R)-1-[(4-AMINO-5H-PYRROLO[3,2-D]PYRIMIDIN-7-YL)METHYL]-4-({[(S)-HYDROXY(3-HYDROXYPROPOXY)PHOSPHORYL]OXY}METHYL)PYRROLIDIN-3-YL]OXY}(HYDROXY)PHOSPHORYL]-3'-O-[(R)-HYDROXY(4-HYDROXYBUTOXY)PHOSPHORYL]-2'-O-METHYLGUANOSINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1DYN1Ligand/Ion5'-O-[(S)-{[(3R,4R)-1-[(4-AMINO-5H-PYRROLO[3,2-D]PYRIMIDIN-7-YL)METHYL]-4-({[(S)-HYDROXY(3-HYDROXYPROPOXY)PHOSPHORYL]OXY}METHYL)PYRROLIDIN-3-YL]OXY}(HYDROXY)PHOSPHORYL]-3'-O-[(R)-HYDROXY(4-HYDROXYBUTOXY)PHOSPHORYL]-2'-O-METHYLGUANOSINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:71 , LEU A:72 , TYR A:73 , VAL A:74 , GLU A:121 , TYR A:123 , VAL A:169 , GLU A:174 , ARG A:177 , GLU A:206 , ASN A:207 , TRP A:209 , GLY A:210 , ARG A:214 , TYR A:233 , LEU A:254 , HOH A:334 , HOH A:336 , HOH A:374 , HOH A:429BINDING SITE FOR RESIDUE DYN A 258
2AC2SOFTWAREASN B:71 , LEU B:72 , TYR B:73 , VAL B:74 , PHE B:94 , GLU B:121 , SER B:122 , TYR B:123 , GLU B:174 , ARG B:177 , GLU B:206 , ASN B:207 , ASN B:208 , TRP B:209 , GLY B:210 , ARG B:214 , TYR B:233 , LEU B:254 , HOH B:317 , HOH B:337 , HOH B:338 , HOH B:348BINDING SITE FOR RESIDUE DYN B 258

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3HIT)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Arg A:44 -Pro A:45
2Gly A:47 -Pro A:48
3Pro A:48 -Pro A:49
4Glu A:196 -Pro A:197
5Arg B:44 -Pro B:45
6Gly B:47 -Pro B:48
7Pro B:48 -Pro B:49
8Glu B:196 -Pro B:197

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3HIT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3HIT)

(-) Exons   (0, 0)

(no "Exon" information available for 3HIT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:257
 aligned with Q2QEH4_SAPOF | Q2QEH4 from UniProtKB/TrEMBL  Length:299

    Alignment length:257
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       
         Q2QEH4_SAPOF    22 VIIYELNLQGTTKAQYSTFLKQLRDDIKDPNLHYGGTNLPVIKRPVGPPKFLRVNLKASTGTVSLAVQRSNLYVAAYLAKNNNKQFRAYYFKGFQITTNQLNNLFPEATGVSNQQELGYGESYPQIQNAAGVTRQQAGLGIKKLAESMTKVNGVARVEKDEALFLLIVVQMVGEAARFKYIENLVLNNFDTAKEVEPVPDRVIILENNWGLLSRAAKTANNGVFQTPLVLTSYAVPGVEWRVTTVAEVEIGIFLNVD 278
               SCOP domains d3hita_ A: automated matches                                                                                                                                                                                                                                      SCOP domains
               CATH domains 3hitA01 A:1-176 Ricin (A subunit), domain 1                                                                                                                                     3hitA02 A:177-257 Ricin (A Subunit), domain 2                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....hhhhhhhhhhhhhhhhh......................eeeeeee....eeeeeee.....eeeeeee.....eeeee......hhhhhhhhhhhhhhhh.eee.....hhhhhhhhhh.hhhhhh.hhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhh....eeeeeeee.........eeeee.hhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hit A   1 VIIYELNLQGTTKAQYSTFLKQLRDDIKDPNLHYGGTNLPVIKRPVGPPKFLRVNLKASTGTVSLAVQRSNLYVAAYLAKNNNKQFRAYYFKGFQITTNQLNNLFPEATGVSNQQELGYGESYPQIQNAAGVTRQQAGLGIKKLAESMTKVNGVARVEKDEALFLLIVVQMVGEAARFKYIENLVLNNFDTAKEVEPVPDRVIILENNWGLLSRAAKTANNGVFQTPLVLTSYAVPGVEWRVTTVAEVEIGIFLNVD 257
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       

Chain B from PDB  Type:PROTEIN  Length:257
 aligned with Q2QEH4_SAPOF | Q2QEH4 from UniProtKB/TrEMBL  Length:299

    Alignment length:257
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       
         Q2QEH4_SAPOF    22 VIIYELNLQGTTKAQYSTFLKQLRDDIKDPNLHYGGTNLPVIKRPVGPPKFLRVNLKASTGTVSLAVQRSNLYVAAYLAKNNNKQFRAYYFKGFQITTNQLNNLFPEATGVSNQQELGYGESYPQIQNAAGVTRQQAGLGIKKLAESMTKVNGVARVEKDEALFLLIVVQMVGEAARFKYIENLVLNNFDTAKEVEPVPDRVIILENNWGLLSRAAKTANNGVFQTPLVLTSYAVPGVEWRVTTVAEVEIGIFLNVD 278
               SCOP domains d3hitb_ B: automated matches                                                                                                                                                                                                                                      SCOP domains
               CATH domains 3hitB01 B:1-176 Ricin (A subunit), domain 1                                                                                                                                     3hitB02 B:177-257 Ricin (A Subunit), domain 2                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....hhhhhhhhhhhhhhhhh......................eeeeeeee..eeeeeeee.....eeeeeee.....eeeee......hhhhhhhhhhhhhhhh.eee.....hhhhhhhhhh.hhhhhh.hhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhh....eeeeeeee.........eeeee.hhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3hit B   1 VIIYELNLQGTTKAQYSTFLKQLRDDIKDPNLHYGGTNLPVIKRPVGPPKFLRVNLKASTGTVSLAVQRSNLYVAAYLAKNNNKQFRAYYFKGFQITTNQLNNLFPEATGVSNQQELGYGESYPQIQNAAGVTRQQAGLGIKKLAESMTKVNGVARVEKDEALFLLIVVQMVGEAARFKYIENLVLNNFDTAKEVEPVPDRVIILENNWGLLSRAAKTANNGVFQTPLVLTSYAVPGVEWRVTTVAEVEIGIFLNVD 257
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HIT)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q2QEH4_SAPOF | Q2QEH4)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0030598    rRNA N-glycosylase activity    Catalysis of the hydrolysis of the N-glycosylic bond at A-4324 in 28S rRNA from rat ribosomes or corresponding sites in 28S RNA from other species.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0017148    negative regulation of translation    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DYN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:44 - Pro A:45   [ RasMol ]  
    Arg B:44 - Pro B:45   [ RasMol ]  
    Glu A:196 - Pro A:197   [ RasMol ]  
    Glu B:196 - Pro B:197   [ RasMol ]  
    Gly A:47 - Pro A:48   [ RasMol ]  
    Gly B:47 - Pro B:48   [ RasMol ]  
    Pro A:48 - Pro A:49   [ RasMol ]  
    Pro B:48 - Pro B:49   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hit
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q2QEH4_SAPOF | Q2QEH4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.2.22
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q2QEH4_SAPOF | Q2QEH4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q2QEH4_SAPOF | Q2QEH43hiq 3his 3hiv 3hiw

(-) Related Entries Specified in the PDB File

3hio 3hiq 3his 3hiv 3hiw