Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL AND FUNCTIONAL CHARACTERIZATION OF A NOVEL HOMODIMERIC THREE-FINGER NEUROTOXIN FROM THE VENOM OF OPHIOPHAGUS HANNAH (KING COBRA)
 
Authors :  A. Roy, X. Zhou, M. Z. Chong, D. D'Hoedt, C. S. Foo, N. Rajagopalan, S. Nirthanan, D. Bertrand, J. Sivaraman, R. M. Kini
Date :  15 May 09  (Deposition) - 12 Jan 10  (Release) - 23 Mar 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.55
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Haditoxin, Three Finger Toxin, Ophiophagus Hannah, Snake Venom, Neurotoxin, Nicotinic Acetylcholine Receptors, Acetylcholine Receptor Inhibitor, Disulfide Bond, Postsynaptic Neurotoxin, Secreted, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Roy, X. Zhou, M. Z. Chong, D. D'Hoedt, C. S. Foo, N. Rajagopalan, S. Nirthanan, D. Bertrand, J. Sivaraman, R. M. Kini
Structural And Functional Characterization Of A Novel Homodimeric Three-Finger Neurotoxin From The Venom Of Ophiophagus Hannah (King Cobra)
J. Biol. Chem. V. 285 8302 2010
PubMed-ID: 20071329  |  Reference-DOI: 10.1074/JBC.M109.074161

(-) Compounds

Molecule 1 - MUSCARINIC TOXIN-LIKE PROTEIN 3 HOMOLOG
    ChainsA, B
    Organism CommonKING COBRA
    Organism ScientificOPHIOPHAGUS HANNAH
    Organism Taxid8665
    SynonymHADITOXIN, MTLP-3 HOMOLOG

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3HH7)

(-) Sites  (0, 0)

(no "Site" information available for 3HH7)

(-) SS Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1A:3 -A:24
2A:17 -A:41
3A:45 -A:57
4A:58 -A:63
5B:3 -B:24
6B:17 -B:41
7B:45 -B:57
8B:58 -B:63

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3HH7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3HH7)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SNAKE_TOXINPS00272 Snake toxins signature.3SO8_OPHHA61-82
 
  2A:40-61
B:40-61

(-) Exons   (0, 0)

(no "Exon" information available for 3HH7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:65
 aligned with 3SO8_OPHHA | A8N286 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:65
                                    31        41        51        61        71        81     
            3SO8_OPHHA   22 TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ 86
               SCOP domains d3hh7a_ A: automated matches                                      SCOP domains
               CATH domains 3hh7A00 A:1-65 CD59                                               CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.........eee......eeeeeeeee..eeeeeeeee.........eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------SNAKE_TOXIN           ---- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                  3hh7 A  1 TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ 65
                                    10        20        30        40        50        60     

Chain B from PDB  Type:PROTEIN  Length:65
 aligned with 3SO8_OPHHA | A8N286 from UniProtKB/Swiss-Prot  Length:86

    Alignment length:65
                                    31        41        51        61        71        81     
            3SO8_OPHHA   22 TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ 86
               SCOP domains d3hh7b_ B: automated matches                                      SCOP domains
               CATH domains 3hh7B00 B:1-65 CD59                                               CATH domains
               Pfam domains ----------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.........eee......eeeeeeeee..eeeeeeeee.........eeeeeee....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------SNAKE_TOXIN           ---- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                  3hh7 B  1 TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ 65
                                    10        20        30        40        50        60     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HH7)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (3SO8_OPHHA | A8N286)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0035792    other organism postsynaptic membrane    A postsynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A postsynaptic membrane is a specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters transmit the signal across the synaptic cleft to the postsynaptic membrane.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3hh7)
 
  Sites
(no "Sites" information available for 3hh7)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3hh7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hh7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  3SO8_OPHHA | A8N286
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  3SO8_OPHHA | A8N286
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3HH7)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3HH7)