![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3HH7) |
(no "Site" information available for 3HH7) |
Asymmetric/Biological Unit
|
(no "Cis Peptide Bond" information available for 3HH7) |
(no "SAP(SNP)/Variant" information available for 3HH7) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 3HH7) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:65 aligned with 3SO8_OPHHA | A8N286 from UniProtKB/Swiss-Prot Length:86 Alignment length:65 31 41 51 61 71 81 3SO8_OPHHA 22 TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ 86 SCOP domains d3hh7a_ A: automated matches SCOP domains CATH domains 3hh7A00 A:1-65 CD59 CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------SNAKE_TOXIN ---- PROSITE Transcript ----------------------------------------------------------------- Transcript 3hh7 A 1 TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ 65 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:65 aligned with 3SO8_OPHHA | A8N286 from UniProtKB/Swiss-Prot Length:86 Alignment length:65 31 41 51 61 71 81 3SO8_OPHHA 22 TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ 86 SCOP domains d3hh7b_ B: automated matches SCOP domains CATH domains 3hh7B00 B:1-65 CD59 CATH domains Pfam domains ----------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------SNAKE_TOXIN ---- PROSITE Transcript ----------------------------------------------------------------- Transcript 3hh7 B 1 TKCYNHQSTTPETTEICPDSGYFCYKSSWIDGREGRIERGCTFTCPELTPNGKYVYCCRRDKCNQ 65 10 20 30 40 50 60
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 3HH7) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (3SO8_OPHHA | A8N286)
|
|
|
|
|
|
|