Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE MYOSTATIN:FOLLISTATIN 288 COMPLEX
 
Authors :  J. N. Cash, T. B. Thompson
Date :  14 May 09  (Deposition) - 04 Aug 09  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.15
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Protein-Protein Complex, Tb Domain, Cystine Knot Motif, Tgf-Beta Fold, Disulfide Linked Dimer, Follistatin Domain (Fsd), Cleavage On Pair Of Basic Residues, Cytokine, Disulfide Bond, Glycoprotein, Growth Factor, Secreted, Signaling Protein-Cytokine Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. N. Cash, C. A. Rejon, A. C. Mcpherron, D. J. Bernard, T. B. Thompson
The Structure Of Myostatin:Follistatin 288: Insights Into Receptor Utilization And Heparin Binding
Embo J. V. 28 2662 2009
PubMed-ID: 19644449  |  Reference-DOI: 10.1038/EMBOJ.2009.205

(-) Compounds

Molecule 1 - GROWTH/DIFFERENTIATION FACTOR 8
    ChainsA, B
    EngineeredYES
    Expression SystemCRICETULUS GRISEUS
    Expression System Cell LineCHO
    Expression System Taxid10029
    FragmentUNP RESIDUES 268-376
    GeneMSTN, GDF8
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    SynonymGDF-8, MYOSTATIN
 
Molecule 2 - FOLLISTATIN
    ChainsC, D
    EngineeredYES
    Expression SystemCRICETULUS GRISEUS
    Expression System Cell LineCHO
    Expression System Taxid10029
    FragmentUNP RESIDUES 30-317
    GeneFST
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFS, ACTIVIN-BINDING PROTEIN

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
1CIT2Ligand/IonCITRIC ACID
2PO43Ligand/IonPHOSPHATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLU A:12 , SER A:13 , ARG A:14 , PRO C:101 , ARG C:134 , TYR D:17 , LYS D:18BINDING SITE FOR RESIDUE PO4 A 110
2AC2SOFTWAREASP B:30 , TRP B:31 , ARG C:192 , THR D:45 , LYS D:48BINDING SITE FOR RESIDUE PO4 B 110
3AC3SOFTWAREVAL C:142 , CYS C:144 , THR C:149 , CYS C:150 , LYS C:232 , SER C:257 , ASN C:259 , LYS C:282 , HOH C:411BINDING SITE FOR RESIDUE PO4 C 289
4AC4SOFTWAREPHE B:2 , ARG C:6 , ALA C:8 , LYS C:9 , GLN C:14 , HOH C:407 , HOH C:409BINDING SITE FOR RESIDUE CIT C 290
5AC5SOFTWAREGLY A:28 , ASP A:30 , TRP A:31 , ASN C:44 , THR C:45 , LYS C:48 , ARG D:192BINDING SITE FOR RESIDUE CIT C 291

(-) SS Bonds  (45, 45)

Asymmetric/Biological Unit
No.Residues
1A:6 -A:16
2A:15 -A:74
3A:43 -A:106
4A:47 -A:108
5A:73 -B:73
6B:6 -B:16
7B:15 -B:74
8B:43 -B:106
9B:47 -B:108
10C:3 -C:26
11C:13 -C:59
12C:27 -C:62
13C:66 -C:77
14C:71 -C:87
15C:89 -C:121
16C:93 -C:114
17C:103 -C:135
18C:139 -C:150
19C:144 -C:160
20C:163 -C:196
21C:167 -C:189
22C:178 -C:210
23C:216 -C:227
24C:221 -C:238
25C:241 -C:273
26C:245 -C:266
27C:255 -C:287
28D:3 -D:26
29D:13 -D:59
30D:27 -D:62
31D:66 -D:77
32D:71 -D:87
33D:89 -D:121
34D:93 -D:114
35D:103 -D:135
36D:139 -D:150
37D:144 -D:160
38D:163 -D:196
39D:167 -D:189
40D:178 -D:210
41D:216 -D:227
42D:221 -D:238
43D:241 -D:273
44D:245 -D:266
45D:255 -D:287

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ala A:34 -Pro A:35
2Ala B:34 -Pro B:35

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric/Biological Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_049091E152QFST_HUMANPolymorphism11745088C/DE123Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (3, 10)

Asymmetric/Biological Unit (3, 10)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1TBPS51364 TGF-beta binding (TB) domain profile.FST_HUMAN30-91
 
  2C:1-62
D:1-62
2KAZAL_2PS51465 Kazal domain profile.FST_HUMAN117-166
 
190-241
 
268-318
 
  6C:88-137
D:88-137
C:161-212
D:161-212
C:239-288
D:239-287
3TGF_BETA_1PS00250 TGF-beta family signature.GDF8_MOUSE299-314
 
  2A:32-47
B:32-47

(-) Exons   (4, 8)

Asymmetric/Biological Unit (4, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002567591aENSE00001190599chr5:52776239-52776706468FST_HUMAN1-29290--
1.2bENST000002567592bENSE00000743379chr5:52778710-52778901192FST_HUMAN29-93652C:1-64
D:1-64
64
64
1.3aENST000002567593aENSE00000743381chr5:52779334-52779552219FST_HUMAN93-166742C:64-137
D:64-137 (gaps)
74
74
1.4bENST000002567594bENSE00000743382chr5:52779899-52780123225FST_HUMAN166-241762C:137-212 (gaps)
D:137-212 (gaps)
76
76
1.5aENST000002567595aENSE00000743383chr5:52780827-52781057231FST_HUMAN241-318782C:212-288 (gaps)
D:212-287 (gaps)
77
76
1.6dENST000002567596dENSE00001941684chr5:52781781-527829641184FST_HUMAN318-344270--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:109
 aligned with GDF8_MOUSE | O08689 from UniProtKB/Swiss-Prot  Length:376

    Alignment length:109
                                   277       287       297       307       317       327       337       347       357       367         
           GDF8_MOUSE   268 DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS 376
               SCOP domains d3hh2a_ A: automated matches                                                                                  SCOP domains
               CATH domains 3hh2A00 A:1-109 Cystine-knot cytokines                                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eee..eeehhhhh...eee..eee..eee...........hhhhhhhhhh.......eeeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------TGF_BETA_1      -------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 3hh2 A   1 DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS 109
                                    10        20        30        40        50        60        70        80        90       100         

Chain B from PDB  Type:PROTEIN  Length:109
 aligned with GDF8_MOUSE | O08689 from UniProtKB/Swiss-Prot  Length:376

    Alignment length:109
                                   277       287       297       307       317       327       337       347       357       367         
           GDF8_MOUSE   268 DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS 376
               SCOP domains d3hh2b_ B: automated matches                                                                                  SCOP domains
               CATH domains 3hh2B00 B:1-109 Cystine-knot cytokines                                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............eee..eeehhhhh...eee..eee..eee...........hhhhhhhhhh.......eeeeeeeeeeeeeee.....eeeeeeeeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------TGF_BETA_1      -------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------- Transcript
                 3hh2 B   1 DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS 109
                                    10        20        30        40        50        60        70        80        90       100         

Chain C from PDB  Type:PROTEIN  Length:278
 aligned with FST_HUMAN | P19883 from UniProtKB/Swiss-Prot  Length:344

    Alignment length:288
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309        
            FST_HUMAN    30 GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN 317
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee.....eeeeee...hhhhhh.......eee....hhhhhhhhhhhh......ee.............eeeee.....eeeee............eee....ee.hhhhhhhhhhhh.....eeee................eeee.....eeee........-----..eee....ee.hhhhhhhhhhhhh....eeee.......hhhhh......eeeee....eeeee.......-----..eee....ee.hhhhhhhhhhhhh....eeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------Q--------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE TB  PDB: C:1-62 UniProt: 30-91                                -------------------------KAZAL_2  PDB: C:88-137 UniProt: 117-166           -----------------------KAZAL_2  PDB: C:161-212 UniProt: 190-241            --------------------------KAZAL_2  PDB: C:239-288 UniProt: 268-318           PROSITE
           Transcript 1 (1) Exon 1.2b  PDB: C:1-64 UniProt: 29-93 [INCOMPLETE]              ------------------------------------------------------------------------Exon 1.4b  PDB: C:137-212 (gaps) UniProt: 166-241                           ---------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3a  PDB: C:64-137 UniProt: 93-166                                  --------------------------------------------------------------------------Exon 1.5a  PDB: C:212-288 (gaps) UniProt: 241-318 [INCOMPLETE]                Transcript 1 (2)
                 3hh2 C   1 GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPE-----QYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCP-----EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN 288
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160        |-    |  180       190       200       210       220       230       240     |   - |     260       270       280        
                                                                                                                                                                                                  169   175                                                                    246   252                                    

Chain D from PDB  Type:PROTEIN  Length:275
 aligned with FST_HUMAN | P19883 from UniProtKB/Swiss-Prot  Length:344

    Alignment length:287
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       
            FST_HUMAN    30 GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee.....eeeeee...hhhhhh.......eee....hhhhhhhhhhhh......ee.............eeee..---..eeee............eee....ee.hhhhhhhhhhhh.....eeee................eeee.....eeee........----...eee....ee.hhhhhhhhhhhhh....eeee.......hhhhh......eeeee....eeeee.......-----..eee....ee.hhhhhhhhhhhhh....eeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------Q-------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE TB  PDB: D:1-62 UniProt: 30-91                                -------------------------KAZAL_2  PDB: D:88-137 UniProt: 117-166           -----------------------KAZAL_2  PDB: D:161-212 UniProt: 190-241            --------------------------KAZAL_2  PDB: D:239-287 UniProt: 268-318          PROSITE
           Transcript 1 (1) Exon 1.2b  PDB: D:1-64 UniProt: 29-93 [INCOMPLETE]              ------------------------------------------------------------------------Exon 1.4b  PDB: D:137-212 (gaps) UniProt: 166-241                           --------------------------------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.3a  PDB: D:64-137 (gaps) UniProt: 93-166                           --------------------------------------------------------------------------Exon 1.5a  PDB: D:212-287 (gaps) UniProt: 241-318 [INCOMPLETE]               Transcript 1 (2)
                 3hh2 D   1 GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMN---KPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPE----EQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCP-----EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 287
                                    10        20        30        40        50        60        70        80   |    90       100       110       120       130       140       150       160        |-   |   180       190       200       210       220       230       240     |   - |     260       270       280       
                                                                                                          80  84                                                                                  169  174                                                                     246   252                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3HH2)

(-) Gene Ontology  (51, 53)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (GDF8_MOUSE | O08689)
molecular function
    GO:0005125    cytokine activity    Functions to control the survival, growth, differentiation and effector function of tissues and cells.
    GO:0008083    growth factor activity    The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
    GO:0008201    heparin binding    Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0005160    transforming growth factor beta receptor binding    Interacting selectively and non-covalently with the transforming growth factor beta receptor.
biological process
    GO:0060395    SMAD protein signal transduction    The cascade of processes by which a signal interacts with a receptor, causing a change in the activity of a SMAD protein, and ultimately effecting a change in the functioning of the cell.
    GO:0048468    cell development    The process whose specific outcome is the progression of the cell over time, from its formation to the mature structure. Cell development does not include the steps involved in committing a cell to a specific fate.
    GO:0071549    cellular response to dexamethasone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a dexamethasone stimulus.
    GO:0040007    growth    The increase in size or mass of an entire organism, a part of an organism or a cell.
    GO:0046716    muscle cell cellular homeostasis    The cellular homeostatic process that preserves a muscle cell in a stable functional or structural state.
    GO:0046627    negative regulation of insulin receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of insulin receptor signaling.
    GO:0033673    negative regulation of kinase activity    Any process that stops, prevents, or reduces the frequency, rate or extent of kinase activity, the catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0014741    negative regulation of muscle hypertrophy    Any process that stops, prevents, or reduces the frequency, rate, or extent of muscle hypertrophy.
    GO:0045662    negative regulation of myoblast differentiation    Any process that stops, prevents, or reduces the frequency, rate or extent of myoblast differentiation. A myoblast is a mononucleate cell type that, by fusion with other myoblasts, gives rise to the myotubes that eventually develop into skeletal muscle fibers.
    GO:2000818    negative regulation of myoblast proliferation    Any process that stops, prevents or reduces the frequency, rate or extent of myoblast proliferation.
    GO:0051898    negative regulation of protein kinase B signaling    Any process that stops, prevents, or reduces the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
    GO:1902725    negative regulation of satellite cell differentiation    Any process that stops, prevents or reduces the frequency, rate or extent of satellite cell differentiation.
    GO:1902723    negative regulation of skeletal muscle satellite cell proliferation    Any process that stops, prevents or reduces the frequency, rate or extent of satellite cell proliferation.
    GO:0048632    negative regulation of skeletal muscle tissue growth    Any process that stops, prevents, or reduces the frequency, rate or extent of skeletal muscle growth.
    GO:0022602    ovulation cycle process    A process involved in the sexual cycle seen in females, often with physiologic changes in the endometrium that recur at regular intervals during the reproductive years.
    GO:0002230    positive regulation of defense response to virus by host    Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
    GO:0098779    positive regulation of macromitophagy in response to mitochondrial depolarization    The macromitophagy process that is triggered by a detection of the loss of mitochondrial membrane potential.
    GO:0010862    positive regulation of pathway-restricted SMAD protein phosphorylation    Any process that increases the rate, frequency or extent of pathway-restricted SMAD protein phosphorylation. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0043408    regulation of MAPK cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the MAP kinase (MAPK) cascade.
    GO:0042981    regulation of apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process.
    GO:0051602    response to electrical stimulus    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an electrical stimulus.
    GO:0043627    response to estrogen    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by an estrogen, C18 steroid hormones that can stimulate the development of female sexual characteristics.
    GO:0045471    response to ethanol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
    GO:0051384    response to glucocorticoid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
    GO:0009629    response to gravity    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a gravitational stimulus.
    GO:0009408    response to heat    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
    GO:0014850    response to muscle activity    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a muscle activity stimulus.
    GO:0033574    response to testosterone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a testosterone stimulus.
    GO:0014732    skeletal muscle atrophy    A process, occurring in skeletal muscle, that is characterized by a decrease in protein content, fiber diameter, force production and fatigue resistance in response to different conditions such as starvation, aging and disuse.
    GO:0043403    skeletal muscle tissue regeneration    The regrowth of skeletal muscle tissue to repair injured or damaged muscle fibers in the postnatal stage.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0098792    xenophagy    The macroautophagy process in which a region of cytoplasm containing an intracellular pathogen or some part of an intracellular pathogen (e.g. viral capsid) is enclosed in a double membrane bound autophagosome, which then fuses with the lysosome leading to degradation of the contents.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Chain C,D   (FST_HUMAN | P19883)
molecular function
    GO:0048185    activin binding    Interacting selectively and non-covalently with activin, a dimer of inhibin-beta subunits.
    GO:0043395    heparan sulfate proteoglycan binding    Interacting selectively and non-covalently with a heparan sulfate proteoglycan, any proteoglycan containing heparan sulfate as the glycosaminoglycan carbohydrate unit.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
    GO:0002244    hematopoietic progenitor cell differentiation    The process in which precursor cell type acquires the specialized features of a hematopoietic progenitor cell, a class of cell types including myeloid progenitor cells and lymphoid progenitor cells.
    GO:0032926    negative regulation of activin receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of any activin receptor signaling pathway.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0051798    positive regulation of hair follicle development    Any process that activates or increases the frequency, rate or extent of hair follicle development.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CIT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:34 - Pro A:35   [ RasMol ]  
    Ala B:34 - Pro B:35   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3hh2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FST_HUMAN | P19883
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  GDF8_MOUSE | O08689
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FST_HUMAN | P19883
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  GDF8_MOUSE | O08689
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FST_HUMAN | P198832b0u 2p6a 5jhw
        GDF8_MOUSE | O086893sek 5ji1

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3HH2)