3HBH - JenaLib

Title :   CLASS IV CHITINASE STRUCTURE FROM PICEA ABIES AT 2.25A

Authors :   W. Ubhayasekera, S. L. Mowbray

Date :   04 May 09 (Deposition) - 11 Aug 09 (Release) - 01 Sep 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.25

Chains :   Asym./Biol. Unit : A

Keywords :   Endochitinase, Chitinase, Class Iv, Family 19, Conformational Changes, Chitin-Binding, Glycosidase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   W. Ubhayasekera, R. Rawat, S. W. Ho, M. Wiweger, S. Von Arnold, M. L. Chye, S. L. Mowbray
The First Crystal Structures Of A Family 19 Class Iv Chitinase: The Enzyme From Norway Spruce.
Plant Mol. Biol. V. 71 277 2009
PubMed-ID: 19629717 | Reference-DOI: 10.1007/S11103-009-9523-9
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (3, 3)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:204
 aligned with Q6WSR8_PICAB | Q6WSR8 from UniProtKB/TrEMBL  Length:276

    Alignment length:204
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272    
         Q6WSR8_PICAB    73 SVGGIISQSFFNGLAGGAASSCEGKGFYTYNAFIAAANAYSGFGTTGSNDVKKRELAAFFANVMHETGGLCYINEKNPPINYCQSSSTWPCTSGKSYHGRGPLQLSWNYNYGAAGKSIGFDGLNNPEKVGQDSTISFKTAVWFWMKNSNCHSAITSGQGFGGTIKAINSMECNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 276
               SCOP domains d3hbha_ A: automated matches                                                                                                                                                                                 SCOP domains
               CATH domains -------------------------------------------------------------------------3hbhA02 A:121-178 Endochitinase, domain 2                 ------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh...........hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhh......................................hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.hhhhhhh..hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3hbh A  48 SVGGIISQSFFNGLAGGAASSCEGKGFYTYNAFIAAANAYSGFGTTGSNDVKKRELAAFFANVMHETGGLCYINEKNPPINYCQSSSTWPCTSGKSYHGRGPLQLSWNYNYGAAGKSIGFDGLNNPEKVGQDSTISFKTAVWFWMKNSNCHSAITSGQGFGGTIKAINSMECNGGNSGEVSSRVNYYKKICSQLGVDPGANVSC 251
                                    57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (Q6WSR8_PICAB | Q6WSR8)

molecular function
	GO:0008061	chitin binding	Interacting selectively and non-covalently with chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.
	GO:0004568	chitinase activity	Catalysis of the hydrolysis of (1->4)-beta linkages of N-acetyl-D-glucosamine (GlcNAc) polymers of chitin and chitodextrins.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016798	hydrolase activity, acting on glycosyl bonds	Catalysis of the hydrolysis of any glycosyl bond.
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0016998	cell wall macromolecule catabolic process	The chemical reactions and pathways resulting in the breakdown of macromolecules that form part of a cell wall.
	GO:0006032	chitin catabolic process	The chemical reactions and pathways resulting in the breakdown of chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3hbh)

	Sites
(no "Sites" information available for 3hbh)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3hbh)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3hbh
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q6WSR8_PICAB \| Q6WSR8
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	3.2.1.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description