Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE KINASE DOMAIN OF TYPE I ACTIVIN RECEPTOR (ACVR1) IN COMPLEX WITH FKBP12 AND DORSOMORPHIN
 
Authors :  A. Chaikuad, I. Alfano, B. Shrestha, J. R. C. Muniz, K. Petrie, O. Fedoro C. Phillips, S. Bishop, P. Mahajan, A. C. W. Pike, F. Von Delft, C. H. Ar A. M. Edwards, J. Weigelt, C. Bountra, S. Knapp, A. Bullock, Structura Genomics Consortium (Sgc)
Date :  30 Apr 09  (Deposition) - 02 Jun 09  (Release) - 28 Nov 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.35
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Structural Genomics Consortium, Sgc, Atp- Binding, Disease Mutation, Glycoprotein, Kinase, Magnesium, Manganese, Membrane, Metal-Binding, Nucleotide-Binding, Phosphoprotein, Receptor, Serine/Threonine-Protein Kinase, Transferase, Transmembrane, Isomerase, Rotamase, Isomerase-Protein Kinase Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Chaikuad, I. Alfano, G. Kerr, C. E. Sanvitale, J. H. Boergermann, J. T. Triffitt, F. Von Delft, S. Knapp, P. Knaus, A. N. Bullock
Structure Of The Bone Morphogenetic Protein Receptor Alk2 And Implications For Fibrodysplasia Ossificans Progressiva.
J. Biol. Chem. V. 287 36990 2012
PubMed-ID: 22977237  |  Reference-DOI: 10.1074/JBC.M112.365932

(-) Compounds

Molecule 1 - ACTIVIN RECEPTOR TYPE-1
    ChainsA
    EC Number2.7.11.30
    EngineeredYES
    Expression SystemBACULOVIRUS
    Expression System PlasmidPFB-LIC-BSE
    Expression System Taxid10469
    Expression System Vector TypePLASMID
    FragmentACVR1 KINASE DOMAIN (RESIDUE 172-499)
    GeneACVR1, ACVRLK2
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymACTIVIN RECEPTOR TYPE I, ACTR-I, SERINE/THREONINE-PROTEIN KINASE RECEPTOR R1, SKR1, ACTIVIN RECEPTOR-LIKE KINASE 2, ALK-2, TGF- B SUPERFAMILY RECEPTOR TYPE I, TSR-I
 
Molecule 2 - PEPTIDYL-PROLYL CIS-TRANS ISOMERASE FKBP1A
    ChainsB
    EC Number5.2.1.8
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPNIC28-BSA4
    Expression System StrainBL21(DE3)-R3
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentFKBP12
    GeneFKBP1, FKBP12, FKBP1A
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPPIASE FKBP1A, FK506-BINDING PROTEIN 1A, FKBP-1A, ROTAMASE, IMMUNOPHILIN FKBP12, 12 KDA FKBP, FKBP-12

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 9)

Asymmetric/Biological Unit (3, 9)
No.NameCountTypeFull Name
1PG43Ligand/IonTETRAETHYLENE GLYCOL
2SO45Ligand/IonSULFATE ION
3TAK1Ligand/Ion6-[4-(2-PIPERIDIN-1-YLETHOXY)PHENYL]-3-PYRIDIN-4-YLPYRAZOLO[1,5-A]PYRIMIDINE

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:175 , GLY A:176 , GLU A:212 , VAL A:214 , ALA A:233 , LYS A:235 , THR A:283 , HIS A:284 , TYR A:285 , HIS A:286 , GLU A:287 , GLY A:289 , LEU A:343 , HOH A:576BINDING SITE FOR RESIDUE TAK A 1
2AC2SOFTWAREHOH A:121 , HOH A:122 , HOH A:123 , HIS A:284 , HIS A:286 , LYS A:345 , LYS A:346 , HOH A:518 , HOH A:559BINDING SITE FOR RESIDUE SO4 A 500
3AC3SOFTWAREHOH A:43 , HOH A:93 , ARG A:380 , ASN A:437 , ASP A:438 , PRO A:439BINDING SITE FOR RESIDUE SO4 A 2
4AC4SOFTWAREARG A:206 , SER A:272 , GLN B:54 , HOH B:138BINDING SITE FOR RESIDUE SO4 A 3
5AC5SOFTWARESER A:440 , ARG A:490 , LYS A:493BINDING SITE FOR RESIDUE SO4 A 4
6AC6SOFTWAREARG A:218 , LYS A:338 , HOH A:512 , HOH A:513BINDING SITE FOR RESIDUE SO4 A 5
7AC7SOFTWAREHOH A:11 , LEU A:184 , GLU A:230 , ASN A:231 , LEU A:263 , GLY A:264 , HIS A:284 , HIS A:286BINDING SITE FOR RESIDUE PG4 A 6
8AC8SOFTWAREHOH A:45 , HOH A:80 , THR A:179 , LEU A:210 , TRP A:223 , GLU A:230 , ILE A:236 , GLN A:278BINDING SITE FOR RESIDUE PG4 A 7
9AC9SOFTWARETYR A:432 , ASP A:433 , VAL A:435 , ASN A:437 , LYS A:497 , HOH A:568 , HOH A:569BINDING SITE FOR RESIDUE PG4 A 8

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3H9R)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3H9R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (8, 8)

Asymmetric/Biological Unit (8, 8)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_058419R202IACVR1_HUMANDisease (FOP)387906591AR202I
2UniProtVAR_028444R206HACVR1_HUMANDisease (FOP)121912678AR206H
3UniProtVAR_058420Q207EACVR1_HUMANDisease (FOP)  ---AQ207E
4UniProtVAR_058421G328EACVR1_HUMANDisease (FOP)387906589AG328E
5UniProtVAR_058422G328RACVR1_HUMANDisease (FOP)  ---AG328R
6UniProtVAR_058423G328WACVR1_HUMANDisease (FOP)387906588AG328W
7UniProtVAR_058424G356DACVR1_HUMANDisease (FOP)121912679AG356D
8UniProtVAR_058425R375PACVR1_HUMANDisease (FOP)387906590AR375P

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (4, 4)

Asymmetric/Biological Unit (4, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FKBP_PPIASEPS50059 FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.FKB1A_HUMAN20-108  1B:20-108
2GSPS51256 GS domain profile.ACVR1_HUMAN178-207  1A:178-207
3PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.ACVR1_HUMAN214-235  1A:214-235
4PROTEIN_KINASE_STPS00108 Serine/Threonine protein kinases active-site signature.ACVR1_HUMAN332-344  1A:332-344

(-) Exons   (4, 4)

Asymmetric/Biological Unit (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000004001371aENSE00001561754chr20:1373806-1373606201FKB1A_HUMAN1-13131B:2-1312
1.1fENST000004001371fENSE00001107838chr20:1373525-137347848FKB1A_HUMAN13-29171B:13-2917
1.4ENST000004001374ENSE00000858591chr20:1356247-1356135113FKB1A_HUMAN29-66381B:29-6638
1.5aENST000004001375aENSE00000858590chr20:1352884-1352720165FKB1A_HUMAN67-108421B:67-10842
1.7fENST000004001377fENSE00001872186chr20:1350716-13496221095FKB1A_HUMAN-00--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:312
 aligned with ACVR1_HUMAN | Q04771 from UniProtKB/Swiss-Prot  Length:509

    Alignment length:328
                                   181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491        
          ACVR1_HUMAN   172 TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID 499
               SCOP domains d3h9ra_ A: automated matches                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 3h9rA01 A:172-287 Phosphorylase Kinase; domain 1                                                                    3h9rA02 A:288-499 Transferase(Phosphotransferase) domain 1                                                                                                                                                           CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhh..........hhhhhhhhhh..eeeeeeeee..eeeeeeee..eeeeeeee...hhhhhhhhhhhhhhh.........eeeeeee.---..eeeeee......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.........eee....hhh.eee.....eee......eee-------------...hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhh........hhhhhhhhhhhhhhhhhhh....hhhhh.hhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ------------------------------I---HE------------------------------------------------------------------------------------------------------------------------E---------------------------D------------------P---------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------R--------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------W--------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ------GS  PDB: A:178-207            ------PROTEIN_KINASE_ATP    ------------------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3h9r A 172 TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTS---STQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMH-------------RVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID 499
                                   181       191       201       211       221       231       241       251       261       271|   |  281       291       301       311       321       331       341       351       361         -   |   381       391       401       411       421       431       441       451       461       471       481       491        
                                                                                                                              272 276                                                                                  361           375                                                                                                                            

Chain B from PDB  Type:PROTEIN  Length:107
 aligned with FKB1A_HUMAN | P62942 from UniProtKB/Swiss-Prot  Length:108

    Alignment length:107
                                    11        21        31        41        51        61        71        81        91       101       
          FKB1A_HUMAN     2 GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE 108
               SCOP domains d3h9rb_ B: FK-506 binding protein (FKBP12), an immunophilin                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee............eeeeeeeeee....eeee.......eeee......hhhhhhhhhh.....eeeeee.hhhh...............eeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------FKBP_PPIASE  PDB: B:20-108 UniProt: 20-108                                                PROSITE
           Transcript 1 (1) Exon 1.1a   ---------------Exon 1.4  PDB: B:29-66 UniProt: 29-66 Exon 1.5a  PDB: B:67-108 UniProt: 67-108   Transcript 1 (1)
           Transcript 1 (2) -----------Exon 1.1f        ------------------------------------------------------------------------------- Transcript 1 (2)
                 3h9r B   2 GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE 108
                                    11        21        31        41        51        61        71        81        91       101       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3H9R)

(-) Gene Ontology  (103, 108)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ACVR1_HUMAN | Q04771)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0046332    SMAD binding    Interacting selectively and non-covalently with a SMAD signaling protein.
    GO:0048185    activin binding    Interacting selectively and non-covalently with activin, a dimer of inhibin-beta subunits.
    GO:0016361    activin receptor activity, type I    Combining with activin-bound type II activin receptor to initiate a change in cell activity; upon binding, acts as a downstream transducer of activin signals.
    GO:0019838    growth factor binding    Interacting selectively and non-covalently with any growth factor, proteins or polypeptides that stimulate a cell or organism to grow or proliferate.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0017046    peptide hormone binding    Interacting selectively and non-covalently with any peptide with hormonal activity in animals.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004674    protein serine/threonine kinase activity    Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0004702    signal transducer, downstream of receptor, with serine/threonine kinase activity    Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0050431    transforming growth factor beta binding    Interacting selectively and non-covalently with TGF-beta, transforming growth factor beta, a multifunctional peptide that controls proliferation, differentiation and other functions in many cell types.
    GO:0005025    transforming growth factor beta receptor activity, type I    Combining with a complex of transforming growth factor beta and a type II TGF-beta receptor to initiate a change in cell activity; upon binding, acts as a downstream transducer of TGF-beta signals.
    GO:0004675    transmembrane receptor protein serine/threonine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
biological process
    GO:0030509    BMP signaling pathway    A series of molecular signals initiated by the binding of a member of the BMP (bone morphogenetic protein) family to a receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0000082    G1/S transition of mitotic cell cycle    The mitotic cell cycle transition by which a cell in G1 commits to S phase. The process begins with the build up of G1 cyclin-dependent kinase (G1 CDK), resulting in the activation of transcription of G1 cyclins. The process ends with the positive feedback of the G1 cyclins on the G1 CDK which commits the cell to S phase, in which DNA replication is initiated.
    GO:0032924    activin receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to an activin receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0002526    acute inflammatory response    Inflammation which comprises a rapid, short-lived, relatively uniform response to acute injury or antigenic challenge and is characterized by accumulations of fluid, plasma proteins, and granulocytic leukocytes. An acute inflammatory response occurs within a matter of minutes or hours, and either resolves within a few days or becomes a chronic inflammatory response.
    GO:0003289    atrial septum primum morphogenesis    The process in which anatomical structure of an atrial septum primum is generated and organized.
    GO:0001569    branching involved in blood vessel morphogenesis    The process of coordinated growth and sprouting of blood vessels giving rise to the organized vascular system.
    GO:0060923    cardiac muscle cell fate commitment    The commitment of cells to specific cardiac muscle cell fates and their capacity to differentiate into cardiac muscle cells. Cardiac muscle cells are striated muscle cells that are responsible for heart contraction.
    GO:0071773    cellular response to BMP stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a bone morphogenetic protein (BMP) stimulus.
    GO:0071385    cellular response to glucocorticoid stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
    GO:0007368    determination of left/right symmetry    The establishment of an organism's body plan or part of an organism with respect to the left and right halves. The pattern can either be symmetric, such that the halves are mirror images, or asymmetric where the pattern deviates from this symmetry.
    GO:0003143    embryonic heart tube morphogenesis    The process in which the anatomical structures of the embryonic heart tube are generated and organized. The embryonic heart tube is an epithelial tube that will give rise to the mature heart.
    GO:0061445    endocardial cushion cell fate commitment    The commitment of a cell to an endocardial cushion cell fate and its capacity to differentiate into an endocardial cushion cell.
    GO:0007369    gastrulation    A complex and coordinated series of cellular movements that occurs at the end of cleavage during embryonic development of most animals. The details of gastrulation vary from species to species, but usually result in the formation of the three primary germ layers, ectoderm, mesoderm and endoderm.
    GO:0001702    gastrulation with mouth forming second    A gastrulation process in which the initial invagination becomes the anus and the mouth forms second.
    GO:0007281    germ cell development    The process whose specific outcome is the progression of an immature germ cell over time, from its formation to the mature structure (gamete). A germ cell is any reproductive cell in a multicellular organism.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0001701    in utero embryonic development    The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
    GO:0007498    mesoderm development    The process whose specific outcome is the progression of the mesoderm over time, from its formation to the mature structure. The mesoderm is the middle germ layer that develops into muscle, bone, cartilage, blood and connective tissue.
    GO:0001707    mesoderm formation    The process that gives rise to the mesoderm. This process pertains to the initial formation of the structure from unspecified parts.
    GO:0003183    mitral valve morphogenesis    The process in which the structure of the mitral valve is generated and organized.
    GO:0032926    negative regulation of activin receptor signaling pathway    Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of any activin receptor signaling pathway.
    GO:2001237    negative regulation of extrinsic apoptotic signaling pathway    Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway.
    GO:0009968    negative regulation of signal transduction    Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
    GO:0001755    neural crest cell migration    The characteristic movement of cells from the dorsal ridge of the neural tube to a variety of locations in a vertebrate embryo.
    GO:0060389    pathway-restricted SMAD protein phosphorylation    The process of introducing a phosphate group on to a pathway restricted SMAD protein. A pathway restricted SMAD protein is an effector protein that acts directly downstream of the transforming growth factor family receptor.
    GO:0018107    peptidyl-threonine phosphorylation    The phosphorylation of peptidyl-threonine to form peptidyl-O-phospho-L-threonine.
    GO:0060037    pharyngeal system development    The process whose specific outcome is the progression of the pharyngeal system over time, from its formation to the mature structure. The pharyngeal system is a transient embryonic complex that is specific to vertebrates. It comprises the pharyngeal arches, bulges of tissues of mesoderm and neural crest derivation through which pass nerves and pharyngeal arch arteries. The arches are separated internally by pharyngeal pouches, evaginations of foregut endoderm, and externally by pharyngeal clefts, invaginations of surface ectoderm. The development of the system ends when the stucture it contributes to are forming: the thymus, thyroid, parathyroids, maxilla, mandible, aortic arch, cardiac outflow tract, external and middle ear.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0030501    positive regulation of bone mineralization    Any process that activates or increases the frequency, rate or extent of bone mineralization.
    GO:0030335    positive regulation of cell migration    Any process that activates or increases the frequency, rate or extent of cell migration.
    GO:2000017    positive regulation of determination of dorsal identity    Any process that activates or increases the frequency, rate or extent of determination of dorsal identity.
    GO:0045669    positive regulation of osteoblast differentiation    Any process that activates or increases the frequency, rate or extent of osteoblast differentiation.
    GO:0010862    positive regulation of pathway-restricted SMAD protein phosphorylation    Any process that increases the rate, frequency or extent of pathway-restricted SMAD protein phosphorylation. Pathway-restricted SMAD proteins and common-partner SMAD proteins are involved in the transforming growth factor beta receptor signaling pathways.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0030278    regulation of ossification    Any process that modulates the frequency, rate or extent of bone formation.
    GO:0023014    signal transduction by protein phosphorylation    A process in which the transfer of one or more phosphate groups to a substrate transmits a signal to the phosphorylated substrate.
    GO:0051145    smooth muscle cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a smooth muscle cell; smooth muscle lacks transverse striations in its constituent fibers and are almost always involuntary.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0007178    transmembrane receptor protein serine/threonine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses serine/threonine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0048179    activin receptor complex    A protein complex that acts as an activin receptor. Heterodimeric activin receptors, comprising one Type I activin receptor and one Type II receptor polypeptide, and heterotrimeric receptors have been observed.
    GO:0045177    apical part of cell    The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain B   (FKB1A_HUMAN | P62942)
molecular function
    GO:0005528    FK506 binding    Interacting selectively and non-covalently with the 23-membered macrolide lactone FK506.
    GO:0046332    SMAD binding    Interacting selectively and non-covalently with a SMAD signaling protein.
    GO:0048185    activin binding    Interacting selectively and non-covalently with activin, a dimer of inhibin-beta subunits.
    GO:0019855    calcium channel inhibitor activity    Stops, prevents, or reduces the activity of a calcium channel.
    GO:0044325    ion channel binding    Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0005527    macrolide binding    Interacting selectively and non-covalently with a macrolide, any of a large group of structurally related antibiotics produced by Streptomyces species.
    GO:0003755    peptidyl-prolyl cis-trans isomerase activity    Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
    GO:0005160    transforming growth factor beta receptor binding    Interacting selectively and non-covalently with the transforming growth factor beta receptor.
    GO:0034713    type I transforming growth factor beta receptor binding    Interacting selectively and non-covalently with a type I transforming growth factor beta receptor.
biological process
    GO:0006458    'de novo' protein folding    The process of assisting in the folding of a nascent peptide chain into its correct tertiary structure.
    GO:0007183    SMAD protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex that contains SMAD proteins.
    GO:0042110    T cell activation    The change in morphology and behavior of a mature or immature T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
    GO:1990000    amyloid fibril formation    The generation of amyloid fibrils, insoluble fibrous protein aggregates exhibiting beta sheet structure, from proteins. An example of this is seen when human RIP1 and RIP3 kinases form a heterodimeric functional amyloid signaling complex (PMID:22817896).
    GO:0070588    calcium ion transmembrane transport    A process in which a calcium ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0061077    chaperone-mediated protein folding    The process of inhibiting aggregation and assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that is dependent on interaction with a chaperone.
    GO:0003007    heart morphogenesis    The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0060347    heart trabecula formation    The process of creating a trabecula in the heart. A trabecula is a tissue element in the form of a small beam, strut or rod.
    GO:0051280    negative regulation of release of sequestered calcium ion into cytosol    Any process that stops, prevents, or reduces the frequency, rate or extent of the release into the cytosolic compartment of calcium ions sequestered in the endoplasmic reticulum or mitochondria.
    GO:0060315    negative regulation of ryanodine-sensitive calcium-release channel activity    Any process that decreases the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
    GO:0043123    positive regulation of I-kappaB kinase/NF-kappaB signaling    Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
    GO:0032092    positive regulation of protein binding    Any process that activates or increases the frequency, rate or extent of protein binding.
    GO:0031398    positive regulation of protein ubiquitination    Any process that activates or increases the frequency, rate or extent of the addition of ubiquitin groups to a protein.
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0022417    protein maturation by protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure that results in the attainment of the full functional capacity of a protein.
    GO:0000413    protein peptidyl-prolyl isomerization    The modification of a protein by cis-trans isomerization of a proline residue.
    GO:0042026    protein refolding    The process carried out by a cell that restores the biological activity of an unfolded or misfolded protein, using helper proteins such as chaperones.
    GO:0032925    regulation of activin receptor signaling pathway    Any process that modulates the frequency, rate or extent of the activity of any activin receptor signaling pathway.
    GO:1902991    regulation of amyloid precursor protein catabolic process    Any process that modulates the frequency, rate or extent of amyloid precursor protein catabolic process.
    GO:0050776    regulation of immune response    Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
    GO:0032880    regulation of protein localization    Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location.
    GO:0060314    regulation of ryanodine-sensitive calcium-release channel activity    Any process that modulates the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
    GO:0007179    transforming growth factor beta receptor signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a transforming growth factor beta receptor on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0055010    ventricular cardiac muscle tissue morphogenesis    The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
    GO:0030018    Z disc    Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005789    endoplasmic reticulum membrane    The lipid bilayer surrounding the endoplasmic reticulum.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0014802    terminal cisterna    The portion of sarcoplasmic reticulum devoted to calcium ion storage and calcium ion release.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PG4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TAK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3h9r)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3h9r
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACVR1_HUMAN | Q04771
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FKB1A_HUMAN | P62942
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.30
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  5.2.1.8
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  135100
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ACVR1_HUMAN | Q04771
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FKB1A_HUMAN | P62942
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ACVR1_HUMAN | Q047713mtf 3oom 3q4u 4bgg 4c02 4dym
        FKB1A_HUMAN | P629421a7x 1b6c 1bkf 1bl4 1d6o 1d7h 1d7i 1d7j 1eym 1f40 1fap 1fkb 1fkd 1fkf 1fkg 1fkh 1fki 1fkj 1fkr 1fks 1fkt 1j4h 1j4i 1j4r 1nsg 1qpf 1qpl 1tco 2dg3 2dg4 2dg9 2fap 2fke 2nd5 2ppn 2ppo 2ppp 2rse 3fap 3mdy 4dh0 4fap 4ipx 4n19 4odp 4odq 4odr 5i7p 5i7q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3H9R)