Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  THREE-DIMENSIONAL STRUCTURE OF N-TERMINAL DOMAIN OF DNAB HELICASE FROM HELICOBACTER PYLORI AND ITS INTERACTIONS WITH PRIMASE
 
Authors :  T. Kashav, R. Nitharwal, A. A. Syed, A. Gabdoulkhakov, W. Saenger, K. S. Dhar, S. Gourinath
Date :  03 Apr 09  (Deposition) - 26 Jan 10  (Release) - 26 Jan 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  A (1x),B (1x),C (1x),D (1x)
Keywords :  Hexameric Helicase, Helicobacter Pylori, Primase, Replication, Atp-Binding, Autocatalytic Cleavage, Dna Replication, Dna-Binding Hydrolase, Nucleotide-Binding, Primosome, Dna-Binding, Helicase, Hydrolase, Hydrolase/Replication Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Kashav, R. Nitharwal, S. A. Abdulrehman, A. Gabdoulkhakov, W. Saenger, S. K. Dhar, S. Gourinath
Three-Dimensional Structure Of N-Terminal Domain Of Dnab Helicase And Helicase-Primase Interactions In Helicobacter Pylori
Plos One V. 4 E7515 2009
PubMed-ID: 19841750  |  Reference-DOI: 10.1371/JOURNAL.PONE.0007515
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - REPLICATIVE DNA HELICASE
    ChainsA, B
    EC Number3.6.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28A
    Expression System StrainBL21
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentN-TERMINAL DOMAIN, RESIDUES 1-121
    GeneHP_1362
    Organism ScientificHELICOBACTER PYLORI
    Organism Taxid210
 
Molecule 2 - REPLICATIVE DNA HELICASE
    ChainsC
    EC Number3.6.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28A
    Expression System StrainBL21
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 101-122
    GeneHP_1362
    Organism ScientificHELICOBACTER PYLORI
    Organism Taxid210
 
Molecule 3 - REPLICATIVE DNA HELICASE
    ChainsD
    EC Number3.6.1.-
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28A
    Expression System StrainBL21
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentRESIDUES 98-123
    GeneHP_1362
    Organism ScientificHELICOBACTER PYLORI
    Organism Taxid210

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)ABCD
Biological Unit 2 (1x)A (1x)B (1x)C (1x)D (1x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3GXV)

(-) Sites  (0, 0)

(no "Site" information available for 3GXV)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3GXV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3GXV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3GXV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3GXV)

(-) Exons   (0, 0)

(no "Exon" information available for 3GXV)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:122
 aligned with DNAB_HELPY | O25916 from UniProtKB/Swiss-Prot  Length:488

    Alignment length:122
                                    10        20        30        40        50        60        70        80        90       100       110       120  
           DNAB_HELPY     1 MDHLKHLQQLQNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALKLHEEDCPIDENFIRQKMPKDKQIKEEDLVAIFAASPIDNIEAYVEEIKNASIKRKLFGLANTIREQAL 122
               SCOP domains -------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhh..hhhhh.hhhhhhhhhhhhhhhhh....hhhhhhhh.......hhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 3gxv A   1 MDHLKHLQQLQNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALKLHEEDCPIDENFIRQKMPKDKQIKEEDLVAIFAASPIDNIEAYVEEIKNASIKRKLFGLANTIREQAH 122
                                    10        20        30        40        50        60        70        80        90       100       110       120  

Chain B from PDB  Type:PROTEIN  Length:123
 aligned with DNAB_HELPY | O25916 from UniProtKB/Swiss-Prot  Length:488

    Alignment length:123
                                    10        20        30        40        50        60        70        80        90       100       110       120   
           DNAB_HELPY     1 MDHLKHLQQLQNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALKLHEEDCPIDENFIRQKMPKDKQIKEEDLVAIFAASPIDNIEAYVEEIKNASIKRKLFGLANTIREQALE 123
               SCOP domains --------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhh....hhhhhhhh.......hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------- Transcript
                 3gxv B   1 MDHLKHLQQLQNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFEIALKLHEEDCPIDENFIRQKMPKDKQIKEEDLVAIFAASPIDNIEAYVEEIKNASIKRKLFGLANTIREQAHH 123
                                    10        20        30        40        50        60        70        80        90       100       110       120   

Chain C from PDB  Type:PROTEIN  Length:22
 aligned with DNAB_HELPY | O25916 from UniProtKB/Swiss-Prot  Length:488

    Alignment length:22
                                   110       120  
           DNAB_HELPY   101 IKNASIKRKLFGLANTIREQAL 122
               SCOP domains ---------------------- SCOP domains
               CATH domains ---------------------- CATH domains
               Pfam domains ---------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------- SAPs(SNPs)
                    PROSITE ---------------------- PROSITE
                 Transcript ---------------------- Transcript
                 3gxv C 101 IKNASIKRKLFGLANTIREQAL 122
                                   110       120  

Chain D from PDB  Type:PROTEIN  Length:26
 aligned with DNAB_HELPY | O25916 from UniProtKB/Swiss-Prot  Length:488

    Alignment length:26
                                   107       117      
           DNAB_HELPY    98 VEEIKNASIKRKLFGLANTIREQALE 123
               SCOP domains -------------------------- SCOP domains
               CATH domains -------------------------- CATH domains
               Pfam domains -------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------- SAPs(SNPs)
                    PROSITE -------------------------- PROSITE
                 Transcript -------------------------- Transcript
                 3gxv D  98 VEEIKNASIKRKLFGLANTIREQALE 123
                                   107       117      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3GXV)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3GXV)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3GXV)

(-) Gene Ontology  (11, 11)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (DNAB_HELPY | O25916)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003678    DNA helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA helix.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0032508    DNA duplex unwinding    The process in which interchain hydrogen bonds between two strands of DNA are broken or 'melted', generating a region of unpaired single strands.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006269    DNA replication, synthesis of RNA primer    The synthesis of a short RNA polymer, usually 4-15 nucleotides long, using one strand of unwound DNA as a template; the RNA then serves as a primer from which DNA polymerases extend synthesis.
cellular component
    GO:1990077    primosome complex    Any of a family of protein complexes that form at the origin of replication or stalled replication forks and function in replication primer synthesis in all organisms. Early complexes initiate double-stranded DNA unwinding. The core unit consists of a replicative helicase and a primase. The helicase further unwinds the DNA and recruits the polymerase machinery. The primase synthesizes RNA primers that act as templates for complementary stand replication by the polymerase machinery. The primosome contains a number of associated proteins and protein complexes and contributes to the processes of replication initiation, lagging strand elongation, and replication restart.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3gxv)
 
  Sites
(no "Sites" information available for 3gxv)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3gxv)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3gxv
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DNAB_HELPY | O25916
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.6.1.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  DNAB_HELPY | O25916
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DNAB_HELPY | O259164a1f 4zc0

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3GXV)