3F3Y - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC SULFOTRANSFERASE SULT2A1 IN COMPLEX WITH PAP AND LITHOCHOLIC ACID

Authors :   P. W. Pan, A. Dong, M. Amaya, A. M. Edwards

Date :   31 Oct 08 (Deposition) - 15 Sep 09 (Release) - 15 Sep 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Sult2A1, Human Cytosolic Sulfotransferase, Lithocholic Acid, Pap, Bile Acid Catabolism, Cytoplasm, Lipid Metabolism, Steroid Metabolism, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. W. Pan, A. Dong, M. Amaya, A. M. Edwards
Rystal Structure Of Human Cytosolic Sulfotransferase Sult2A1 In Complex With Pap And Lithocholic Acid
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - BILE SALT SULFOTRANSFERASE
	Chains	:	A, B, C, D
	EC Number	:	2.8.2.14
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A-LIC
	Expression System Strain	:	BL21(DE3) CODON PLUS RIL
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	HST, STD, SULT2A1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	HYDROXYSTEROID SULFOTRANSFERASE, HST, DEHYDROEPIANDROSTERONE SULFOTRANSFERASE, DHEA-ST, ST2, ST2A3

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 8)

No.	Name	Count	Type	Full Name
1	4OA	4	Ligand/Ion	(3BETA,5BETA,14BETA,17ALPHA)-3-HYDROXYCHOLAN-24-OICACID
2	A3P	4	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE

Biological Unit 1 (2, 4)

No.	Name	Count	Type	Full Name
1	4OA	2	Ligand/Ion	(3BETA,5BETA,14BETA,17ALPHA)-3-HYDROXYCHOLAN-24-OICACID
2	A3P	2	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	4OA	2	Ligand/Ion	(3BETA,5BETA,14BETA,17ALPHA)-3-HYDROXYCHOLAN-24-OICACID
2	A3P	2	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PHE A:18 , TRP A:72 , ILE A:82 , HIS A:99 , PHE A:133 , LEU A:234 , TYR A:238 , HOH A:302 , HOH A:339 , HOH A:423	BINDING SITE FOR RESIDUE 4OA A 326
2	AC2	SOFTWARE	LYS B:44 , SER B:45 , GLY B:46 , THR B:47 , ASN B:48 , TRP B:49 , ARG B:121 , SER B:129 , TYR B:184 , SER B:218 , SER B:219 , PHE B:220 , MET B:223 , LEU B:245 , LEU B:246 , ARG B:247 , LYS B:248 , GLY B:249 , HOH B:291 , HOH B:295 , HOH B:315 , HOH B:440	BINDING SITE FOR RESIDUE A3P B 701
3	AC3	SOFTWARE	LYS A:44 , SER A:45 , GLY A:46 , THR A:47 , ASN A:48 , TRP A:49 , ARG A:121 , SER A:129 , TYR A:184 , SER A:218 , SER A:219 , PHE A:220 , MET A:223 , LEU A:245 , LEU A:246 , ARG A:247 , LYS A:248 , GLY A:249 , HOH A:288 , HOH A:302 , HOH A:411 , HOH A:413 , HOH A:414 , HOH A:416 , HOH A:423	BINDING SITE FOR RESIDUE A3P A 702
4	AC4	SOFTWARE	PHE B:18 , TRP B:72 , TRP B:77 , ILE B:82 , HIS B:99 , MET B:137 , PHE B:139 , LEU B:234 , TYR B:238 , HOH B:315 , HOH B:354 , HOH B:440	BINDING SITE FOR RESIDUE 4OA B 327
5	AC5	SOFTWARE	LYS C:44 , SER C:45 , GLY C:46 , THR C:47 , ASN C:48 , TRP C:49 , ARG C:121 , SER C:129 , TYR C:184 , SER C:218 , SER C:219 , PHE C:220 , MET C:223 , LEU C:245 , LEU C:246 , ARG C:247 , LYS C:248 , GLY C:249 , HOH C:295 , HOH C:306 , HOH C:316 , HOH C:321 , HOH C:353	BINDING SITE FOR RESIDUE A3P C 704
6	AC6	SOFTWARE	PRO C:14 , TRP C:72 , TRP C:77 , ILE C:82 , HIS C:99 , MET C:137 , TYR C:238 , HOH C:289 , HOH C:313 , HOH C:316	BINDING SITE FOR RESIDUE 4OA C 329
7	AC7	SOFTWARE	LYS D:44 , SER D:45 , GLY D:46 , THR D:47 , ASN D:48 , TRP D:49 , ARG D:121 , SER D:129 , TYR D:184 , SER D:218 , SER D:219 , PHE D:220 , MET D:223 , LEU D:245 , LEU D:246 , ARG D:247 , LYS D:248 , GLY D:249 , HOH D:287 , HOH D:302 , HOH D:329 , HOH D:335	BINDING SITE FOR RESIDUE A3P D 703
8	AC8	SOFTWARE	PHE D:18 , TRP D:72 , TRP D:77 , ILE D:82 , HIS D:99 , PHE D:133 , PHE D:139 , TYR D:238 , HOH D:312 , HOH D:335 , HOH D:430	BINDING SITE FOR RESIDUE 4OA D 328

(no "SS Bond" information available for 3F3Y)

Asymmetric Unit

No.	Residues
1	Ser A:92	-	Pro A:93
2	Ala A:243	-	Gln A:244
3	Ser B:92	-	Pro B:93
4	Ala B:243	-	Gln B:244
5	Ser C:92	-	Pro C:93
6	Ala C:243	-	Gln C:244
7	Trp C:284	-	Glu C:285
8	Ser D:92	-	Pro D:93
9	Ala D:243	-	Gln D:244
10	Trp D:284	-	Glu D:285

Asymmetric Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052520	A	63	P	ST2A1_HUMAN	Polymorphism	11569681	A/B/C/D	A	63	P
2	UniProt	VAR_052521	A	261	T	ST2A1_HUMAN	Polymorphism	11569679	A/B/C/D	A	261	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052520	A	63	P	ST2A1_HUMAN	Polymorphism	11569681	A/B	A	63	P
2	UniProt	VAR_052521	A	261	T	ST2A1_HUMAN	Polymorphism	11569679	A/B	A	261	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (2, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052520	A	63	P	ST2A1_HUMAN	Polymorphism	11569681	C/D	A	63	P
2	UniProt	VAR_052521	A	261	T	ST2A1_HUMAN	Polymorphism	11569679	C/D	A	261	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3F3Y)

Asymmetric Unit (6, 24)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000222002	1	ENSE00001321232	chr19:48389654-48389379	276	ST2A1_HUMAN	1-46	46	4	A:4-46 B:4-46 C:4-46 D:4-46	43 43 43 43
1.2	ENST00000222002	2	ENSE00000715991	chr19:48387042-48386834	209	ST2A1_HUMAN	46-115	70	4	A:46-115 B:46-115 C:46-115 D:46-115	70 70 70 70
1.3	ENST00000222002	3	ENSE00000715969	chr19:48385467-48385341	127	ST2A1_HUMAN	116-158	43	4	A:116-158 B:116-158 C:116-158 D:116-158	43 43 43 43
1.4	ENST00000222002	4	ENSE00000715962	chr19:48382387-48382293	95	ST2A1_HUMAN	158-189	32	4	A:158-189 B:158-189 C:158-189 D:158-189	32 32 32 32
1.5	ENST00000222002	5	ENSE00000715952	chr19:48378091-48377914	178	ST2A1_HUMAN	190-249	60	4	A:190-249 B:190-249 C:190-249 D:190-249	60 60 60 60
1.6	ENST00000222002	6	ENSE00001310164	chr19:48374824-48373723	1102	ST2A1_HUMAN	249-285	37	4	A:249-285 B:249-285 C:249-285 D:249-285	37 37 37 37

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:282
 aligned with ST2A1_HUMAN | Q06520 from UniProtKB/Swiss-Prot  Length:285

    Alignment length:282
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283  
          ST2A1_HUMAN     4 DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
               SCOP domains d3f3ya_ A: Hydroxysteroid sulfotransferase sult2a1                                                                                                                                                                                                                                         SCOP domains
               CATH domains 3f3yA00 A:4-285 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eee..eee.....hhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhh..........hhhhhh....hhhhhhhhhh.....eeee..hhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.........................hhhhhh.hhhhhhhhhhhhhhhh...hhhhh... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------P-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:4-46 UniProt: 1-46        ---------------------------------------------------------------------Exon 1.3  PDB: A:116-158 UniProt: 116-158  -------------------------------Exon 1.5  PDB: A:190-249 UniProt: 190-249                   ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.2  PDB: A:46-115 UniProt: 46-115                               ------------------------------------------Exon 1.4  PDB: A:158-189        -----------------------------------------------------------Exon 1.6  PDB: A:249-285              Transcript 1 (2)
                 3f3y A   4 DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283

Chain B from PDB  Type:PROTEIN  Length:282
 aligned with ST2A1_HUMAN | Q06520 from UniProtKB/Swiss-Prot  Length:285

    Alignment length:282
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283  
          ST2A1_HUMAN     4 DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
               SCOP domains d3f3yb_ B: Hydroxysteroid sulfotransferase sult2a1                                                                                                                                                                                                                                         SCOP domains
               CATH domains 3f3yB00 B:4-285 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eee..eee.....hhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhh..........hhhhhh....hhhhhhhhhh.....eeee..hhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.........................hhhhhh.hhhhhhhhhhhhhhhh...hhhhh... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------P-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:4-46 UniProt: 1-46        ---------------------------------------------------------------------Exon 1.3  PDB: B:116-158 UniProt: 116-158  -------------------------------Exon 1.5  PDB: B:190-249 UniProt: 190-249                   ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.2  PDB: B:46-115 UniProt: 46-115                               ------------------------------------------Exon 1.4  PDB: B:158-189        -----------------------------------------------------------Exon 1.6  PDB: B:249-285              Transcript 1 (2)
                 3f3y B   4 DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283

Chain C from PDB  Type:PROTEIN  Length:282
 aligned with ST2A1_HUMAN | Q06520 from UniProtKB/Swiss-Prot  Length:285

    Alignment length:282
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283  
          ST2A1_HUMAN     4 DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
               SCOP domains d3f3yc_ C: Hydroxysteroid sulfotransferase sult2a1                                                                                                                                                                                                                                         SCOP domains
               CATH domains 3f3yC00 C:4-285 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eee..eee.....hhhhhhhhhhh.......eeee.....hhhhhhhhhhhhhh..........hhhhhh....hhhhhhhhhh.....eeee..hhhhhhhhhh....eeeeee.hhhhhhhhhhhhh..........hhhhhhhhhhhh.....hhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.........................hhhhhh.hhhhhhhhhhhhhhhhh..hhhhh... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------P-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1  PDB: C:4-46 UniProt: 1-46        ---------------------------------------------------------------------Exon 1.3  PDB: C:116-158 UniProt: 116-158  -------------------------------Exon 1.5  PDB: C:190-249 UniProt: 190-249                   ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.2  PDB: C:46-115 UniProt: 46-115                               ------------------------------------------Exon 1.4  PDB: C:158-189        -----------------------------------------------------------Exon 1.6  PDB: C:249-285              Transcript 1 (2)
                 3f3y C   4 DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283

Chain D from PDB  Type:PROTEIN  Length:282
 aligned with ST2A1_HUMAN | Q06520 from UniProtKB/Swiss-Prot  Length:285

    Alignment length:282
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283  
          ST2A1_HUMAN     4 DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
               SCOP domains d3f3yd_ D: Hydroxysteroid sulfotransferase sult2a1                                                                                                                                                                                                                                         SCOP domains
               CATH domains 3f3yD00 D:4-285 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eee..eee.....hhhhhhhhhhh.......eeee.....hhhhhhhhhhhhhh..........hhhhhh....hhhhhhhhhh.....eeee..hhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.........................hhhhhh.hhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------P-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------T------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.1  PDB: D:4-46 UniProt: 1-46        ---------------------------------------------------------------------Exon 1.3  PDB: D:116-158 UniProt: 116-158  -------------------------------Exon 1.5  PDB: D:190-249 UniProt: 190-249                   ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------Exon 1.2  PDB: D:46-115 UniProt: 46-115                               ------------------------------------------Exon 1.4  PDB: D:158-189        -----------------------------------------------------------Exon 1.6  PDB: D:249-285              Transcript 1 (2)
                 3f3y D   4 DFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE 285
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: P-loop containing nucleoside triphosphate hydrolases (2083)

Superfamily: P-loop containing nucleoside triphosphate hydrolases (2083)

Family: PAPS sulfotransferase (54)

Protein domain: Hydroxysteroid sulfotransferase sult2a1 (6)

Human (Homo sapiens) [TaxId: 9606] (6)

1a	d3f3ya_	A:
1b	d3f3yb_	B:
1c	d3f3yc_	C:
1d	d3f3yd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Human (Homo sapiens) (413)

1a	3f3yA00	A:4-285
1b	3f3yB00	B:4-285
1c	3f3yC00	C:4-285
1d	3f3yD00	D:4-285

(no "Pfam Domain" information available for 3F3Y)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (ST2A1_HUMAN | Q06520)

molecular function
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0047704	bile-salt sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + taurolithocholate = adenosine 3',5'-bisphosphate + taurolithocholate sulfate.
	GO:0004304	estrone sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + estrone = adenosine 3',5'-bisphosphate + estrone 3-sulfate.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0050294	steroid sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenolic steroid = adenosine 3',5'-bisphosphate + steroid O-sulfate.
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	The chemical reactions and pathways involving 3'-phosphoadenosine 5'-phosphosulfate, a naturally occurring mixed anhydride. It is an intermediate in the formation of a variety of sulfo compounds in biological systems.
	GO:0030573	bile acid catabolic process	The chemical reactions and pathways resulting in the breakdown of bile acids, any of a group of steroid carboxylic acids occurring in bile.
	GO:0007586	digestion	The whole of the physical, chemical, and biochemical processes carried out by multicellular organisms to break down ingested nutrients into components that may be easily absorbed and directed into metabolism.
	GO:0016042	lipid catabolic process	The chemical reactions and pathways resulting in the breakdown of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0051923	sulfation	The addition of a sulfate group to a molecule.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		4OA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		A3P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:243 - Gln A:244	[ RasMol ]
		Ala B:243 - Gln B:244	[ RasMol ]
		Ala C:243 - Gln C:244	[ RasMol ]
		Ala D:243 - Gln D:244	[ RasMol ]
		Ser A:92 - Pro A:93	[ RasMol ]
		Ser B:92 - Pro B:93	[ RasMol ]
		Ser C:92 - Pro C:93	[ RasMol ]
		Ser D:92 - Pro D:93	[ RasMol ]
		Trp C:284 - Glu C:285	[ RasMol ]
		Trp D:284 - Glu D:285	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3f3y
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST2A1_HUMAN \| Q06520
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ST2A1_HUMAN \| Q06520
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ST2A1_HUMAN \| Q06520	:	1efh 1j99 1ov4 2qp3 2qp4 4ifb

(no "Related Entries Specified in the PDB File" available for 3F3Y)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (10, 10)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (0, 0)

Exons (6, 24)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File