|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3ELX) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3ELX) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3ELX) |
Exons (0, 0)| (no "Exon" information available for 3ELX) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:134 aligned with Q6IMW5_DANRE | Q6IMW5 from UniProtKB/TrEMBL Length:131 Alignment length:134 1 131 | 9 19 29 39 49 59 69 79 89 99 109 119 129 | Q6IMW5_DANRE - -MAFNGKWETESQEGYEPFCKLIGIPDDVIAKGRDFKLVTEIVQNGDDFTWTQYYPNNHVVTNKFIVGKESDMETVGGKKFKGIVSMEGGKLTISFPKYQQTTEISGGKLVETSTASGAQGTAVLVRTSKKV-- - SCOP domains d3elxa_ A: automated matches SCOP domains CATH domains 3elxA00 A:-1-132 [code=2.40.128.20, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript 3elx A -1 GSAFNGKWETESQEGYEPFCKLIGIPDDVIAKGRDFKLVTEIVQNGDDFTWTQYYPNNHVVTNKFIVGKESDMETVGGKKFKGIVSMEGGKLTISFPKYQQTTEISGGKLVETSTASGAQGTAVLVRTSKKVLV 132 8 18 28 38 48 58 68 78 88 98 108 118 128
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3ELX) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q6IMW5_DANRE | Q6IMW5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|