|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 10)
Asymmetric Unit (3, 10)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3ELK) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3ELK) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3ELK) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3ELK) |
Exons (0, 0)| (no "Exon" information available for 3ELK) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:105 aligned with Q9HL84_THEAC | Q9HL84 from UniProtKB/TrEMBL Length:117 Alignment length:106 15 25 35 45 55 65 75 85 95 105 Q9HL84_THEAC 6 TRERILHGLITLYILKELVKRPMHGYELQKSMFETTGQALPQGSIYILLKTMKERGFVISESSVNEKGQQLTVYHITDAGKKFLCDHSQALQLARKIIDDLLSTVD 111 SCOP domains d3elka_ A: automated matches SCOP domains CATH domains 3elkA00 A:6-111 'winged helix' repressor DNA binding domain CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 3elk A 6 TRERILHGLITLYILKELVKRPmHGYELQKSmFETTGQALPQGSIYILLKTmKERGFVISESSVN-KGQQLTVYHITDAGKKFLcDHSQALQLARKIIDDLLSTVD 111 15 25 | 35 | 45 55 | 65 | | 75 85 | 95 105 28-MSE 37-MSE 57-MSE 70 | 90-OCS 72 Chain B from PDB Type:PROTEIN Length:103 aligned with Q9HL84_THEAC | Q9HL84 from UniProtKB/TrEMBL Length:117 Alignment length:104 17 27 37 47 57 67 77 87 97 107 Q9HL84_THEAC 8 ERILHGLITLYILKELVKRPMHGYELQKSMFETTGQALPQGSIYILLKTMKERGFVISESSVNEKGQQLTVYHITDAGKKFLCDHSQALQLARKIIDDLLSTVD 111 SCOP domains d3elkb_ B: automated matches SCOP domains CATH domains 3elkB00 B:8-111 'winged helix' represso r DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 3elk B 8 ERILHGLITLYILKELVKRPmHGYELQKSmFETTGQALP-GSIYILLKTmKERGFVISESSVNEKGQQLTVYHITDAGKKFLcDHSQALQLARKIIDDLLSTVD 111 17 27| 37 |-| 57 67 77 87 | 97 107 28-MSE 37-MSE 46 | 57-MSE 90-OCS 48
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3ELK) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3ELK)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|