|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 6)| Asymmetric Unit (2, 6) Biological Unit 1 (2, 12) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3DF8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3DF8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3DF8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3DF8) |
Exons (0, 0)| (no "Exon" information available for 3DF8) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:109 aligned with Q978X0_THEVO | Q978X0 from UniProtKB/TrEMBL Length:117 Alignment length:110 15 25 35 45 55 65 75 85 95 105 115 Q978X0_THEVO 6 SKACMLRYGDTEICIDPSESVLHLLGKKYTMLIISVLGNGSTRQNFNDIRSSIPGISSTILSRRIKDLIDSGLVERRSGQITTYALTEKGMNVRNSLMPLLQYISVLDRN 115 SCOP domains d3d f8a_ A: automated matches SCOP domains CATH domains 3df 8A00 A:-2-106 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3DF8) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3DF8)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|