Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE PHAGE 434 CRO/OR1 COMPLEX AT 2.5 ANGSTROMS RESOLUTION
 
Authors :  A. Mondragon, S. C. Harrison
Date :  06 Jul 90  (Deposition) - 15 Oct 91  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B,L,R
Keywords :  Protein-Dna Complex, Double Helix, Transcription/Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Mondragon, S. C. Harrison
The Phage 434 Cro/Or1 Complex At 2. 5 A Resolution.
J. Mol. Biol. V. 219 321 1991
PubMed-ID: 2038059  |  Reference-DOI: 10.1016/0022-2836(91)90568-Q
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA (5'- D(*AP*AP*GP*TP*AP*CP*AP*AP*AP*CP*TP*TP*TP*CP*TP*TP*G P*TP*AP*T)-3')
    ChainsA
    EngineeredYES
    SyntheticYES
 
Molecule 2 - DNA (5'- D(*TP*AP*TP*AP*CP*AP*AP*GP*AP*AP*AP*GP*TP*TP*TP*GP*T P*AP*CP*T)-3')
    ChainsB
    EngineeredYES
    SyntheticYES
 
Molecule 3 - PROTEIN (434 CRO)
    ChainsL, R
    Organism ScientificPHAGE 434
    Organism Taxid10712

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABLR

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3CRO)

(-) Sites  (0, 0)

(no "Site" information available for 3CRO)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3CRO)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3CRO)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3CRO)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HTH_CROC1PS50943 Cro/C1-type HTH domain profile.RCRO_BP4348-61
 
  2L:6-59
R:6-59

(-) Exons   (0, 0)

(no "Exon" information available for 3CRO)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:DNA  Length:20
                                                   
                  3cro A  1 AAGTACAAACTTTCTTGTAT 20
                                    10        20

Chain B from PDB  Type:DNA  Length:20
                                                   
                  3cro B  1 TATACAAGAAAGTTTGTACT 20
                                    10        20

Chain L from PDB  Type:PROTEIN  Length:66
 aligned with RCRO_BP434 | P03036 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:66
                                    10        20        30        40        50        60      
            RCRO_BP434    1 MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGTK 66
               SCOP domains d3crol_ L: cro 434                                                 SCOP domains
               CATH domains 3croL00 L:-1-64 lambda repressor-like DNA-binding domains          CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...hhhhhhh.....hhhhhhhhh........hhhhhhh....hhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -------HTH_CROC1  PDB: L:6-59 UniProt: 8-61                  ----- PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                  3cro L -1 MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGTK 64
                                     8        18        28        38        48        58      

Chain R from PDB  Type:PROTEIN  Length:64
 aligned with RCRO_BP434 | P03036 from UniProtKB/Swiss-Prot  Length:71

    Alignment length:64
                                    10        20        30        40        50        60    
            RCRO_BP434    1 MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYG 64
               SCOP domains d3cror_ R: cro 434                                               SCOP domains
               CATH domains 3croR00 R:-1-62 lambda repressor-like DNA-binding domains        CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh...hhhhhhh.....hhhhhhhhh........hhhhhhh....hhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------HTH_CROC1  PDB: R:6-59 UniProt: 8-61                  --- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                  3cro R -1 MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYG 62
                                     8        18        28        38        48        58    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3CRO)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain L,R   (RCRO_BP434 | P03036)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3cro)
 
  Sites
(no "Sites" information available for 3cro)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3cro)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
Insightii
  DNA: ribbon, sticks; protein: ribbon, secondary structure
  DNA: spacefill; protein: ribbon, secondary structure
  DNA: spacefill; protein: ribbon, secondary structure; ball and stick
  spacefill; residue specific coloring
  spacefill; different coloring for DNA and protein
  DNA: spacefill; protein: ribbon, sticks; detailed view of the interaction region
Midas
  DNA: ribbon, plates; protein: ribbon, secondary structure
Setor
  spacefill, chain, specific coloring, stereo
  DNA: sticks; protein: ribbon, secondary structure
Distance Plot
  representative atoms: CA, O3*

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3cro
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RCRO_BP434 | P03036
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  RCRO_BP434 | P03036
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RCRO_BP434 | P030361zug 2cro

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3CRO)