Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE DTDP-4-KETO-L-RHAMNOSE REDUCTASE RELATED PROTEIN (OTHER FORM) FROM THERMUS THERMOPHILUS HB8
 
Authors :  J. Jeyakanthan, S. P. Kanaujia, K. Sekar, S. Satoh, Y. Kitamura, A. Ebihara, L. Chen, Z. J. Liu, B. C. Wang, S. Yokoyama, S. Kuramitsu, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  02 Apr 08  (Deposition) - 07 Apr 09  (Release) - 07 Apr 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Thermus Thermophilus, Dtdp-4-Keto-L-Rhamnose Reductase, Plasmid, Oxidoreductase, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Jeyakanthan, S. P. Kanaujia, K. Sekar, S. Satoh, Y. Kitamura, A. Ebihara, L. Chen, Z. J. Liu, B. C. Wang, C. Yokoyama, S. Kuramitsu
Structure Of The Dtdp-4-Keto-L-Rhamnose Reductase Related Protein From Thermus Thermophilus Hb8
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PUTATIVE UNCHARACTERIZED PROTEIN TTHB138
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET11A
    Expression System StrainB834(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymDTDP-4-KETO-L-RHAMNOSE REDUCTASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3CQ2)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3CQ2)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1Pro A:40 -Pro A:41
2Glu A:84 -Pro A:85
3Pro B:40 -Pro B:41
4Glu B:84 -Pro B:85
5Pro C:40 -Pro C:41
6Glu C:84 -Pro C:85
7Pro D:40 -Pro D:41
8Glu D:84 -Pro D:85

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3CQ2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3CQ2)

(-) Exons   (0, 0)

(no "Exon" information available for 3CQ2)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:96
 aligned with Q53W28_THET8 | Q53W28 from UniProtKB/TrEMBL  Length:103

    Alignment length:96
                                    16        26        36        46        56        66        76        86        96      
         Q53W28_THET8     7 LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102
               SCOP domains d3cq2a_ A: automated matches                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhh................eeeeeee..eeeeee..........hhhhhhhhhhhhh.....eeeeee......hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                 3cq2 A   7 LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRmTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102
                                    16        26        36        46|       56        66        76        86        96      
                                                                   47-MSE                                                   

Chain B from PDB  Type:PROTEIN  Length:98
 aligned with Q53W28_THET8 | Q53W28 from UniProtKB/TrEMBL  Length:103

    Alignment length:98
                                    14        24        34        44        54        64        74        84        94        
         Q53W28_THET8     5 NPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102
               SCOP domains d3cq2b_ B: automated matches                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh..ee....ee......eeeeeee..eeeeee..........hhhhhhhhhhhhh.....eeeeee......hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                 3cq2 B   5 NPLEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRmTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102
                                    14        24        34        44  |     54        64        74        84        94        
                                                                     47-MSE                                                   

Chain C from PDB  Type:PROTEIN  Length:96
 aligned with Q53W28_THET8 | Q53W28 from UniProtKB/TrEMBL  Length:103

    Alignment length:96
                                    16        26        36        46        56        66        76        86        96      
         Q53W28_THET8     7 LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102
               SCOP domains d3cq2c_ C: automated matches                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhh..ee....ee......eeeeeee..eeeeee..........hhhhhhhhhhhh......eeeeee......hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                 3cq2 C   7 LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRmTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102
                                    16        26        36        46|       56        66        76        86        96      
                                                                   47-MSE                                                   

Chain D from PDB  Type:PROTEIN  Length:96
 aligned with Q53W28_THET8 | Q53W28 from UniProtKB/TrEMBL  Length:103

    Alignment length:96
                                    16        26        36        46        56        66        76        86        96      
         Q53W28_THET8     7 LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRMTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102
               SCOP domains d3cq2d_ D: automated matches                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhh................eeeeeee..eeeeee..........hhhhhhhhhhhh......eeeeee......hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------ Transcript
                 3cq2 D   7 LEAQAWALLEAVYDPELGLDVVNLGLIYDLVVEPPRAYVRmTLTTPGCPLHDSLGEAVRQALSRLPGVEEVEVEVTFEPPWTLARLSEKARRLLGW 102
                                    16        26        36        46|       56        66        76        86        96      
                                                                   47-MSE                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3CQ2)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3CQ2)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3CQ2)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3cq2)
 
  Cis Peptide Bonds
    Glu A:84 - Pro A:85   [ RasMol ]  
    Glu B:84 - Pro B:85   [ RasMol ]  
    Glu C:84 - Pro C:85   [ RasMol ]  
    Glu D:84 - Pro D:85   [ RasMol ]  
    Pro A:40 - Pro A:41   [ RasMol ]  
    Pro B:40 - Pro B:41   [ RasMol ]  
    Pro C:40 - Pro C:41   [ RasMol ]  
    Pro D:40 - Pro D:41   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3cq2
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q53W28_THET8 | Q53W28
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q53W28_THET8 | Q53W28
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q53W28_THET8 | Q53W282cu6 3cq1 3cq3

(-) Related Entries Specified in the PDB File

2cu6
3cq1 OTHER FORM OF THIS PROTEIN
3cq3 OTHER FORM OF THIS PROTEIN RELATED ID: TTK003001362.2 RELATED DB: TARGETDB