Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF FGF RECEPTOR 2 (FGFR2) KINASE DOMAINS TRAPPED IN TRANS-PHOSPHORYLATION REACTION
 
Authors :  H. Chen, M. Mohammadi
Date :  20 Mar 08  (Deposition) - 03 Feb 09  (Release) - 07 Mar 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Biol. Unit 2:  A  (1x)
Keywords :  Kinase Domain, Trans-Phosphorylation, Atp-Binding, Disease Mutation, Ectodermal Dysplasia, Glycoprotein, Heparin-Binding, Immunoglobulin Domain, Lacrimo-Auriculo-Dento-Digital Syndrome, Membrane, Nucleotide-Binding, Phosphoprotein, Receptor, Secreted, Transferase, Transmembrane, Tyrosine-Protein Kinase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Chen, C. F. Xu, J. Ma, A. V. Eliseenkova, W. Li, P. M. Pollock, N. Pitteloud, W. T. Miller, T. A. Neubert, M. Mohammadi
A Crystallographic Snapshot Of Tyrosine Trans-Phosphorylation In Action
Proc. Natl. Acad. Sci. Usa V. 105 19660 2008
PubMed-ID: 19060208  |  Reference-DOI: 10.1073/PNAS.0807752105

(-) Compounds

Molecule 1 - FIBROBLAST GROWTH FACTOR RECEPTOR 2
    ChainsA
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21 (DE3) PLYS-S
    Expression System Taxid562
    FragmentPROTEIN KINASE DOMAIN
    GeneFGFR2, BEK, KGFR, KSAM
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymFGFR-2, KERATINOCYTE GROWTH FACTOR RECEPTOR 2, CD332 ANTIGEN

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A
Biological Unit 2 (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 5)

Asymmetric Unit (3, 5)
No.NameCountTypeFull Name
1ACP1Ligand/IonPHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER
2MG2Ligand/IonMAGNESIUM ION
3PTR2Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 1 (2, 6)
No.NameCountTypeFull Name
1ACP2Ligand/IonPHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER
2MG-1Ligand/IonMAGNESIUM ION
3PTR4Mod. Amino AcidO-PHOSPHOTYROSINE
Biological Unit 2 (2, 3)
No.NameCountTypeFull Name
1ACP1Ligand/IonPHOSPHOMETHYLPHOSPHONIC ACID ADENYLATE ESTER
2MG-1Ligand/IonMAGNESIUM ION
3PTR2Mod. Amino AcidO-PHOSPHOTYROSINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:1631 , ASP A:1644 , ACP A:1803 , HOH A:1901 , HOH A:1902BINDING SITE FOR RESIDUE MG A 1801
2AC2SOFTWAREGLU A:1534 , ASP A:1644 , GLY A:1646 , ACP A:1803BINDING SITE FOR RESIDUE MG A 1802
3AC3SOFTWARELEU A:1487 , GLY A:1488 , GLN A:1494 , VAL A:1495 , ALA A:1515 , LYS A:1517 , VAL A:1564 , GLU A:1565 , ALA A:1567 , ASN A:1571 , ARG A:1630 , ASN A:1631 , LEU A:1633 , ASP A:1644 , MG A:1801 , MG A:1802 , HOH A:1901 , HOH A:1912 , HOH A:1916 , HOH A:1922 , HOH A:1939 , HOH A:1978 , HOH A:1985 , HOH A:1986BINDING SITE FOR RESIDUE ACP A 1803

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3CLY)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3CLY)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (11, 11)

Asymmetric Unit (11, 11)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_023788K526EFGFR2_HUMANDisease (FSPC)121918507AK1526E
02UniProtVAR_017276N549HFGFR2_HUMANDisease (CS)  ---AN1549H
03UniProtVAR_017277E565GFGFR2_HUMANDisease (PS)  ---AE1565G
04UniProtVAR_046071R612TFGFR2_HUMANUnclassified  ---AR1612T
05UniProtVAR_015012G613RFGFR2_HUMANPolymorphism  ---AG1613R
06UniProtVAR_029884A628TFGFR2_HUMANDisease (LADDS)121918509AA1628T
07UniProtVAR_017278K641RFGFR2_HUMANDisease (PS)  ---AK1641R
08UniProtVAR_029885A648TFGFR2_HUMANDisease (LADDS)121918508AA1648T
09UniProtVAR_017279K659NFGFR2_HUMANUnclassified  ---AK1659N
10UniProtVAR_017280G663EFGFR2_HUMANDisease (PS)  ---AG1663E
11UniProtVAR_017281R678GFGFR2_HUMANDisease (CS)  ---AR1678G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (11, 22)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_023788K526EFGFR2_HUMANDisease (FSPC)121918507AK1526E
02UniProtVAR_017276N549HFGFR2_HUMANDisease (CS)  ---AN1549H
03UniProtVAR_017277E565GFGFR2_HUMANDisease (PS)  ---AE1565G
04UniProtVAR_046071R612TFGFR2_HUMANUnclassified  ---AR1612T
05UniProtVAR_015012G613RFGFR2_HUMANPolymorphism  ---AG1613R
06UniProtVAR_029884A628TFGFR2_HUMANDisease (LADDS)121918509AA1628T
07UniProtVAR_017278K641RFGFR2_HUMANDisease (PS)  ---AK1641R
08UniProtVAR_029885A648TFGFR2_HUMANDisease (LADDS)121918508AA1648T
09UniProtVAR_017279K659NFGFR2_HUMANUnclassified  ---AK1659N
10UniProtVAR_017280G663EFGFR2_HUMANDisease (PS)  ---AG1663E
11UniProtVAR_017281R678GFGFR2_HUMANDisease (CS)  ---AR1678G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (11, 11)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_023788K526EFGFR2_HUMANDisease (FSPC)121918507AK1526E
02UniProtVAR_017276N549HFGFR2_HUMANDisease (CS)  ---AN1549H
03UniProtVAR_017277E565GFGFR2_HUMANDisease (PS)  ---AE1565G
04UniProtVAR_046071R612TFGFR2_HUMANUnclassified  ---AR1612T
05UniProtVAR_015012G613RFGFR2_HUMANPolymorphism  ---AG1613R
06UniProtVAR_029884A628TFGFR2_HUMANDisease (LADDS)121918509AA1628T
07UniProtVAR_017278K641RFGFR2_HUMANDisease (PS)  ---AK1641R
08UniProtVAR_029885A648TFGFR2_HUMANDisease (LADDS)121918508AA1648T
09UniProtVAR_017279K659NFGFR2_HUMANUnclassified  ---AK1659N
10UniProtVAR_017280G663EFGFR2_HUMANDisease (PS)  ---AG1663E
11UniProtVAR_017281R678GFGFR2_HUMANDisease (CS)  ---AR1678G

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

Asymmetric Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.FGFR2_HUMAN487-517  1A:1487-1517
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.FGFR2_HUMAN622-634  1A:1622-1634
Biological Unit 1 (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.FGFR2_HUMAN487-517  2A:1487-1517
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.FGFR2_HUMAN622-634  2A:1622-1634
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.FGFR2_HUMAN487-517  1A:1487-1517
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.FGFR2_HUMAN622-634  1A:1622-1634

(-) Exons   (9, 9)

Asymmetric Unit (9, 9)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1hENST000003584871hENSE00001816393chr10:123357598-123357476123FGFR2_HUMAN-00--
1.3aENST000003584873aENSE00002141262chr10:123353481-123353223259FGFR2_HUMAN1-37370--
1.5bENST000003584875bENSE00001099029chr10:123325218-123324952267FGFR2_HUMAN37-126900--
1.6aENST000003584876aENSE00001099020chr10:123324093-12332401678FGFR2_HUMAN126-152270--
1.7ENST000003584877ENSE00001295614chr10:123310973-123310804170FGFR2_HUMAN152-208570--
1.8ENST000003584878ENSE00000812216chr10:123298229-123298106124FGFR2_HUMAN209-250420--
1.15ENST0000035848715ENSE00001099035chr10:123279683-123279493191FGFR2_HUMAN250-313640--
1.18bENST0000035848718bENSE00001146218chr10:123276977-123276833145FGFR2_HUMAN314-362490--
1.19cENST0000035848719cENSE00001448727chr10:123274833-123274631203FGFR2_HUMAN362-429680--
1.21ENST0000035848721ENSE00001015834chr10:123263455-123263304152FGFR2_HUMAN430-480511A:1468-148013
1.22ENST0000035848722ENSE00001627890chr10:123260461-123260340122FGFR2_HUMAN480-521421A:1480-152142
1.23ENST0000035848723ENSE00001146272chr10:123258119-123258009111FGFR2_HUMAN521-558381A:1521-155838
1.24ENST0000035848724ENSE00001146264chr10:123256236-123256046191FGFR2_HUMAN558-621641A:1558-1621 (gaps)64
1.25ENST0000035848725ENSE00001099037chr10:123247627-123247505123FGFR2_HUMAN622-662411A:1622-166241
1.26ENST0000035848726ENSE00001099030chr10:123246938-12324686871FGFR2_HUMAN663-686241A:1663-168624
1.27ENST0000035848727ENSE00001146235chr10:123245046-123244909138FGFR2_HUMAN686-732471A:1686-173247
1.28bENST0000035848728bENSE00002167762chr10:123243317-123243212106FGFR2_HUMAN732-767361A:1732-176736
1.31hENST0000035848731hENSE00001847306chr10:123239535-1232378551681FGFR2_HUMAN768-821541A:1768-17725

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:291
 aligned with FGFR2_HUMAN | P21802 from UniProtKB/Swiss-Prot  Length:821

    Alignment length:305
                                   477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       717       727       737       747       757       767     
         FGFR2_HUMAN    468 LPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDL  772
               SCOP domains d3clya_ A: automated matches                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 3clyA01 A:1468-1566 Phosphorylase Kinase; domain 1                                                 3clyA02 A:1567              -1762 Transferase(Phosphotransferase) domain 1                                                                                                                          ---------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhh.eeeeee........eeeeeee.........eeeeeee......hhhhhhhhhhhhhhhhhhh.......eeeee......eeeee.....hhhhhhhh..--------------....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee......ee.......hhhhhhhhhhhh.eehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------E----------------------H---------------G----------------------------------------------TR--------------T------------R------T----------N---E--------------G---------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------PROTEIN_KINASE_ATP             --------------------------------------------------------------------------------------------------------PROTEIN_KINAS------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.21    ----------------------------------------Exon 1.23  PDB: A:1521-1558           ---------------------------------------------------------------Exon 1.25  PDB: A:1622-1662              Exon 1.26               ---------------------------------------------Exon 1.28b  PDB: A:1732-1767        1.31h Transcript 1 (1)
           Transcript 1 (2) ------------Exon 1.22  PDB: A:1480-1521               ------------------------------------Exon 1.24  PDB: A:1558-1621 (gaps) UniProt: 558-621             ----------------------------------------------------------------Exon 1.27  PDB: A:1686-1732 UniProt: 686-732   ---------------------------------------- Transcript 1 (2)
                3cly A 1468 LPEDPKWEFPRDKLTLGKPLGEGAFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARR--------------EEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDyyKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDL 1772
                                  1477      1487      1497      1507      1517      1527      1537      1547      1557      1567      1577  |      -      1597      1607      1617      1627      1637      1647      1657      1667      1677      1687      1697      1707      1717      1727      1737      1747      1757      1767     
                                                                                                                                         1580           1595                                                         1656-PTR                                                                                                                
                                                                                                                                                                                                                      1657-PTR                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit

(-) CATH Domains  (2, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3CLY)

(-) Gene Ontology  (133, 133)

Asymmetric Unit(hide GO term definitions)
Chain A   (FGFR2_HUMAN | P21802)
molecular function
    GO:0016303    1-phosphatidylinositol-3-kinase activity    Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol + ATP = a 1-phosphatidyl-1D-myo-inositol 3-phosphate + ADP + 2 H(+).
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005088    Ras guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0017134    fibroblast growth factor binding    Interacting selectively and non-covalently with a fibroblast growth factor.
    GO:0005007    fibroblast growth factor-activated receptor activity    Combining with a fibroblast growth factor and transmitting the signal across the plasma membrane to initiate a change in cell activity.
    GO:0008201    heparin binding    Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0046934    phosphatidylinositol-4,5-bisphosphate 3-kinase activity    Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0001525    angiogenesis    Blood vessel formation when new vessels emerge from the proliferation of pre-existing blood vessels.
    GO:0009887    animal organ morphogenesis    Morphogenesis of an animal organ. An organ is defined as a tissue or set of tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0007409    axonogenesis    De novo generation of a long process of a neuron, that carries efferent (outgoing) action potentials from the cell body towards target cells. Refers to the morphogenesis or creation of shape or form of the developing axon.
    GO:0060348    bone development    The process whose specific outcome is the progression of bone over time, from its formation to the mature structure. Bone is the hard skeletal connective tissue consisting of both mineral and cellular components.
    GO:0030282    bone mineralization    The deposition of hydroxyapatite, a form of calcium phosphate with the formula Ca10(PO4)6(OH)2, in bone tissue.
    GO:0060349    bone morphogenesis    The process in which bones are generated and organized.
    GO:0060667    branch elongation involved in salivary gland morphogenesis    The differential growth of the salivary branches along their axis, resulting in the growth of a branch.
    GO:0060670    branching involved in labyrinthine layer morphogenesis    The process in which the branches of the fetal placental villi are generated and organized. The villous part of the placenta is called the labyrinth layer.
    GO:0060442    branching involved in prostate gland morphogenesis    The process in which the branching structure of the prostate gland is generated and organized. A branch is a division or offshoot from a main stem.
    GO:0060445    branching involved in salivary gland morphogenesis    The process in which the branching structure of the salivary gland is generated and organized.
    GO:0048755    branching morphogenesis of a nerve    The process in which the anatomical structures of branches in a nerve are generated and organized. This term refers to an anatomical structure (nerve) not a cell (neuron).
    GO:0060449    bud elongation involved in lung branching    The process in which a bud in the lung grows out from the point where it is formed.
    GO:0045165    cell fate commitment    The commitment of cells to specific cell fates and their capacity to differentiate into particular kinds of cells. Positional information is established through protein signals that emanate from a localized source within a cell (the initial one-cell zygote) or within a developmental field.
    GO:0007267    cell-cell signaling    Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
    GO:0048565    digestive tract development    The process whose specific outcome is the progression of the digestive tract over time, from its formation to the mature structure. The digestive tract is the anatomical structure through which food passes and is processed.
    GO:0048701    embryonic cranial skeleton morphogenesis    The process in which the anatomical structures of the cranial skeleton are generated and organized during the embryonic phase.
    GO:0048557    embryonic digestive tract morphogenesis    The process in which the anatomical structures of the digestive tract are generated and organized during embryonic development. The digestive tract is the anatomical structure through which food passes and is processed.
    GO:0048568    embryonic organ development    Development, taking place during the embryonic phase, of a tissue or tissues that work together to perform a specific function or functions. Development pertains to the process whose specific outcome is the progression of a structure over time, from its formation to the mature structure. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0048562    embryonic organ morphogenesis    Morphogenesis, during the embryonic phase, of a tissue or tissues that work together to perform a specific function or functions. Morphogenesis is the process in which anatomical structures are generated and organized. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that work together to perform a specific function or functions.
    GO:0009880    embryonic pattern specification    The process that results in the patterns of cell differentiation that will arise in an embryo.
    GO:0048730    epidermis morphogenesis    The process in which the anatomical structures of the epidermis are generated and organized. The epidermis is the outer epithelial layer of an animal, it may be a single layer that produces an extracellular material (e.g. the cuticle of arthropods) or a complex stratified squamous epithelium, as in the case of many vertebrate species.
    GO:0030855    epithelial cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
    GO:0060664    epithelial cell proliferation involved in salivary gland morphogenesis    The multiplication or reproduction of epithelial cells of the submandibular salivary gland, resulting in the expansion of a cell population and the shaping of the gland.
    GO:0001837    epithelial to mesenchymal transition    A transition where an epithelial cell loses apical/basolateral polarity, severs intercellular adhesive junctions, degrades basement membrane components and becomes a migratory mesenchymal cell.
    GO:0008543    fibroblast growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
    GO:0035603    fibroblast growth factor receptor signaling pathway involved in hemopoiesis    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands, which contributes to hemopoiesis.
    GO:0060595    fibroblast growth factor receptor signaling pathway involved in mammary gland specification    The series of molecular signals initiated by binding of a fibroblast growth factor to its receptor on the surface of al cell in the epidermis resulting in the formation of the mammary line. The mammary line is a ridge of epidermal cells that will form the mammary placodes.
    GO:0035602    fibroblast growth factor receptor signaling pathway involved in negative regulation of apoptotic process in bone marrow    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands, which stops, prevents, or reduces the frequency, rate or extent of the occurrence or rate of cell death by apoptotic process in the bone marrow.
    GO:0035607    fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex development    The series of molecular signals generated as a consequence of a fibroblast growth factor-type receptor binding to one of its physiological ligands, which contributes to the progression of the orbitofrontal cortex over time from its initial formation until its mature state.
    GO:0035604    fibroblast growth factor receptor signaling pathway involved in positive regulation of cell proliferation in bone marrow    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands, which activates or increases the frequency, rate or extent of cell proliferation in the bone marrow.
    GO:0022612    gland morphogenesis    The process in which the anatomical structures of a gland are generated and organized.
    GO:0031069    hair follicle morphogenesis    The process in which the anatomical structures of the hair follicle are generated and organized.
    GO:0001701    in utero embryonic development    The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
    GO:0042472    inner ear morphogenesis    The process in which the anatomical structures of the inner ear are generated and organized. The inner ear is the structure in vertebrates that contains the organs of balance and hearing. It consists of soft hollow sensory structures (the membranous labyrinth) containing fluid (endolymph) surrounded by fluid (perilymph) and encased in a bony cavity (the bony labyrinth). It consists of two chambers, the sacculus and utriculus, from which arise the cochlea and semicircular canals respectively.
    GO:0032808    lacrimal gland development    The process whose specific outcome is the progression of the lacrimal gland over time, from its formation to the mature structure. The lacrimal gland produces secretions that lubricate and protect the cornea of the eye.
    GO:0060601    lateral sprouting from an epithelium    The process in which a branch forms along the side of an epithelium.
    GO:0060174    limb bud formation    The process pertaining to the initial formation of a limb bud from unspecified parts. This process begins with the formation of a local condensation of mesenchyme cells within the prospective limb field, and ends when a limb bud is recognizable.
    GO:0048286    lung alveolus development    The process whose specific outcome is the progression of the alveolus over time, from its formation to the mature structure. The alveolus is a sac for holding air in the lungs; formed by the terminal dilation of air passageways.
    GO:0030324    lung development    The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
    GO:0060463    lung lobe morphogenesis    The process in which the anatomical structures of a lung lobe are generated and organized. A lung lobe is a projection that extends from the lung.
    GO:0060484    lung-associated mesenchyme development    The biological process whose specific outcome is the progression of a lung-associated mesenchyme from an initial condition to its mature state. This process begins with the formation of lung-associated mesenchyme and ends with the mature structure. Lung-associated mesenchyme is the tissue made up of loosely connected mesenchymal cells in the lung.
    GO:0060615    mammary gland bud formation    The morphogenetic process in which a bud forms from the mammary placode. A mammary bud is bulb of epithelial cells that is distinct from the surrounding epidermis.
    GO:0003149    membranous septum morphogenesis    The process in which the membranous septum is generated and organized. The membranous septum is the upper part of ventricular septum.
    GO:0048762    mesenchymal cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of a mesenchymal cell. A mesenchymal cell is a loosely associated cell that is part of the connective tissue in an organism. Mesenchymal cells give rise to more mature connective tissue cell types.
    GO:0060915    mesenchymal cell differentiation involved in lung development    The process in which a relatively unspecialized cell acquires specialized features of a mesenchymal cell of the lung. A mesenchymal cell is a loosely associated cell that is part of the connective tissue in an organism. Mesenchymal cells give rise to more mature connective tissue cell types.
    GO:0060916    mesenchymal cell proliferation involved in lung development    The multiplication or reproduction of cells, resulting in the expansion of a mesenchymal cell population that contributes to the progression of the lung over time. A mesenchymal cell is a cell that normally gives rise to other cells that are organized as three-dimensional masses, rather than sheets.
    GO:0048333    mesodermal cell differentiation    The process in which a relatively unspecialized cell acquires the specialized features of a mesoderm cell.
    GO:0030901    midbrain development    The process whose specific outcome is the progression of the midbrain over time, from its formation to the mature structure. The midbrain is the middle division of the three primary divisions of the developing chordate brain or the corresponding part of the adult brain (in vertebrates, includes a ventral part containing the cerebral peduncles and a dorsal tectum containing the corpora quadrigemina and that surrounds the aqueduct of Sylvius connecting the third and fourth ventricles).
    GO:0016331    morphogenesis of embryonic epithelium    The process in which the anatomical structures of embryonic epithelia are generated and organized.
    GO:0035264    multicellular organism growth    The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
    GO:0050680    negative regulation of epithelial cell proliferation    Any process that stops, prevents or reduces the rate or extent of epithelial cell proliferation.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0042476    odontogenesis    The process whose specific outcome is the progression of a tooth or teeth over time, from formation to the mature structure(s). A tooth is any hard bony, calcareous, or chitinous organ found in the mouth or pharynx of an animal and used in procuring or masticating food.
    GO:0021769    orbitofrontal cortex development    The progression of the orbitofrontal cortex over time from its initial formation until its mature state. The orbitofrontal cortex is a cerebral cortex region located in the frontal lobe.
    GO:0035265    organ growth    The increase in size or mass of an organ. Organs are commonly observed as visibly distinct structures, but may also exist as loosely associated clusters of cells that function together as to perform a specific function.
    GO:0030916    otic vesicle formation    The process resulting in the transition of the otic placode into the otic vesicle, a transient embryonic structure formed during development of the vertebrate inner ear.
    GO:0003148    outflow tract septum morphogenesis    The process in which the anatomical structures of the outflow tract septum are generated and organized. The outflow tract septum is a partition in the outflow tract.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0046854    phosphatidylinositol phosphorylation    The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
    GO:0036092    phosphatidylinositol-3-phosphate biosynthetic process    The chemical reactions and pathways resulting in the formation of phosphatidylinositol-3-phosphate, a phosphatidylinositol monophosphate carrying the phosphate group at the 3-position.
    GO:0048015    phosphatidylinositol-mediated signaling    A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0043410    positive regulation of MAPK cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the MAPK cascade.
    GO:0030177    positive regulation of Wnt signaling pathway    Any process that activates or increases the frequency, rate or extent of Wnt signal transduction.
    GO:0090263    positive regulation of canonical Wnt signaling pathway    Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
    GO:0060045    positive regulation of cardiac muscle cell proliferation    Any process that activates or increases the frequency, rate or extent of cardiac muscle cell proliferation.
    GO:0045787    positive regulation of cell cycle    Any process that activates or increases the rate or extent of progression through the cell cycle.
    GO:0051781    positive regulation of cell division    Any process that activates or increases the frequency, rate or extent of cell division.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0050679    positive regulation of epithelial cell proliferation    Any process that activates or increases the rate or extent of epithelial cell proliferation.
    GO:0060501    positive regulation of epithelial cell proliferation involved in lung morphogenesis    Any process that increases the rate or frequency of epithelial cell proliferation that results in the lung attaining its shape.
    GO:0002053    positive regulation of mesenchymal cell proliferation    The process of activating or increasing the rate or extent of mesenchymal cell proliferation. Mesenchymal cells are loosely organized embryonic cells.
    GO:0010518    positive regulation of phospholipase activity    Any process that increases the frequency, rate or extent of phospholipase activity, the hydrolysis of a phospholipid.
    GO:0048661    positive regulation of smooth muscle cell proliferation    Any process that activates or increases the rate or extent of smooth muscle cell proliferation.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0009791    post-embryonic development    The process whose specific outcome is the progression of the organism over time, from the completion of embryonic development to the mature structure. See embryonic development.
    GO:0060527    prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis    The branching morphogenesis process in which the prostate epithelial cords branch freely to create the structure of the prostate acini.
    GO:0060523    prostate epithelial cord elongation    The developmental growth process in which solid chords of prostate epithelium increase in length.
    GO:0060512    prostate gland morphogenesis    The process in which the anatomical structures of a prostate gland are generated and organized.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0021860    pyramidal neuron development    The progression of a pyramidal neuron from its initial formation to its mature state.
    GO:0070372    regulation of ERK1 and ERK2 cascade    Any process that modulates the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0060687    regulation of branching involved in prostate gland morphogenesis    Any process that modulates the rate, frequency, or extent of prostate gland branching, the process in which the branching structure of the prostate gland is generated and organized. A branch is a division or offshoot from a main stem.
    GO:0010453    regulation of cell fate commitment    Any process that modulates the frequency, rate or extent of cell fate commitment. Cell fate commitment is the commitment of cells to specific cell fates and their capacity to differentiate into particular kinds of cells. Positional information is established through protein signals that emanate from a localized source within a cell (the initial one-cell zygote) or within a developmental field.
    GO:0040036    regulation of fibroblast growth factor receptor signaling pathway    Any process that modulates the frequency, rate or extent of fibroblast growth factor receptor signaling pathway activity.
    GO:0060688    regulation of morphogenesis of a branching structure    Any process that modulates the rate, frequency, or extent of branching morphogenesis, the process in which the anatomical structures of branches are generated and organized.
    GO:0040014    regulation of multicellular organism growth    Any process that modulates the frequency, rate or extent of growth of the body of an organism so that it reaches its usual body size.
    GO:0045667    regulation of osteoblast differentiation    Any process that modulates the frequency, rate or extent of osteoblast differentiation.
    GO:0033688    regulation of osteoblast proliferation    Any process that modulates the frequency, rate or extent of osteoblast proliferation.
    GO:0014066    regulation of phosphatidylinositol 3-kinase signaling    Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0051150    regulation of smooth muscle cell differentiation    Any process that modulates the frequency, rate or extent of smooth muscle cell differentiation.
    GO:0008589    regulation of smoothened signaling pathway    Any process that modulates the frequency, rate or extent of smoothened signaling.
    GO:0048608    reproductive structure development    The reproductive developmental process whose specific outcome is the progression of structures that will be used in the process of creating new individuals from one or more parents, from their formation to the mature structures.
    GO:0048705    skeletal system morphogenesis    The process in which the anatomical structures of the skeleton are generated and organized.
    GO:0060529    squamous basal epithelial stem cell differentiation involved in prostate gland acinus development    The process in which a relatively unspecialized epithelial cell acquires specialized features of a squamous basal epithelial stem cell of the prostate.
    GO:0001657    ureteric bud development    The process whose specific outcome is the progression of the ureteric bud over time, from its formation to the mature structure.
    GO:0055010    ventricular cardiac muscle tissue morphogenesis    The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
    GO:0021847    ventricular zone neuroblast division    The proliferation of neuroblasts in the ventricular zone of the cerebral cortex. The neuronal progenitors of these cells will migrate radially.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:0005938    cell cortex    The region of a cell that lies just beneath the plasma membrane and often, but not always, contains a network of actin filaments and associated proteins.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0031410    cytoplasmic vesicle    A vesicle found in the cytoplasm of a cell.
    GO:0060076    excitatory synapse    A synapse in which an action potential in the presynaptic cell increases the probability of an action potential occurring in the postsynaptic cell.
    GO:0031012    extracellular matrix    A structure lying external to one or more cells, which provides structural support for cells or tissues.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0043231    intracellular membrane-bounded organelle    Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ACP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PTR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3cly)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3cly
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FGFR2_HUMAN | P21802
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  101600
    Disease InformationOMIM
  123500
    Disease InformationOMIM
  149730
    Disease InformationOMIM
  609579
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FGFR2_HUMAN | P21802
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FGFR2_HUMAN | P218021djs 1e0o 1ev2 1gjo 1ii4 1iil 1nun 1oec 1wvz 2fdb 2psq 2pvf 2pvy 2pwl 2py3 2pz5 2pzp 2pzr 2q0b 3b2t 3caf 3cu1 3dar 3euu 3oj2 3ojm 3ri1 4j23 4j95 4j96 4j97 4j98 4j99 4wv1 5eg3 5ugl 5ugx 5uhn 5ui0

(-) Related Entries Specified in the PDB File

2psq UNPHOSPHORYLATED UNACTIVATED WILD TYPE FGFR2 KINASE DOMAIN
2pvf PHOSPHORYLATED ACTIVATED WILD TYPE FGFR2 KINASE DOMAIN