3CKL - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN CYTOSOLIC SULFOTRANSFERASE SULT1B1 IN COMPLEX WITH PAP AND RESVERATROL

Authors :   P. W. Pan, W. Tempel, A. Dong, P. Loppnau, I. Kozieradzki, A. M. Edwards, C. H. Arrowsmith, J. Weigelt, C. Bountra, A. Bochkarev, J. Min, Structural Genomics Consortium (Sgc)

Date :   16 Mar 08 (Deposition) - 01 Apr 08 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Sult1B1, Human Cytosolic Sulfotransferase, Resveratrol, Sgc, Cytoplasm, Lipid Metabolism, Polymorphism, Steroid Metabolism, Structural Genomics, Structural Genomics Consortium (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. W. Pan, W. Tempel, A. Dong, P. Loppnau, I. Kozieradzki, A. M. Edwards, C. H. Arrowsmith, J. Weigelt, C. Bountra, A. Bochkarev, J. Min
Crystal Structure Of Human Cytosolic Sulfotransferase Sult1B1 In Complex With Pap And Resveratrol.
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - SULFOTRANSFERASE FAMILY CYTOSOLIC 1B MEMBER 1
	Chains	:	A, B
	EC Number	:	2.8.2.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	P28A-LIC
	Expression System Strain	:	BL21(DE3) CODON PLUS RIL (STRATAGENE)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	SULT1B1, ST1B2, SULT1B2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SULFOTRANSFERASE 1B2, THYROID HORMONE SULFOTRANSFERASE

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 4)

No.	Name	Count	Type	Full Name
1	A3P	2	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE
2	STL	2	Ligand/Ion	RESVERATROL

Biological Unit 1 (2, 2)

No.	Name	Count	Type	Full Name
1	A3P	1	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE
2	STL	1	Ligand/Ion	RESVERATROL

Biological Unit 2 (2, 2)

No.	Name	Count	Type	Full Name
1	A3P	1	Ligand/Ion	ADENOSINE-3'-5'-DIPHOSPHATE
2	STL	1	Ligand/Ion	RESVERATROL

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	THR A:21 , PHE A:24 , MET A:81 , LEU A:86 , HIS A:109 , PHE A:143 , GLN A:150 , TYR A:170 , LEU A:244	BINDING SITE FOR RESIDUE STL A 501
2	AC2	SOFTWARE	THR B:21 , PHE B:24 , MET B:81 , HIS B:109 , PHE B:143 , ASN B:147 , GLN B:150 , TYR B:170 , LEU B:244	BINDING SITE FOR RESIDUE STL B 501
3	AC3	SOFTWARE	LYS A:48 , SER A:49 , GLY A:50 , THR A:51 , THR A:52 , TRP A:53 , ARG A:131 , SER A:139 , TYR A:194 , THR A:228 , SER A:229 , PHE A:230 , MET A:233 , PHE A:256 , MET A:257 , ARG A:258 , LYS A:259 , GLY A:260	BINDING SITE FOR RESIDUE A3P A 601
4	AC4	SOFTWARE	LYS B:48 , SER B:49 , GLY B:50 , THR B:51 , THR B:52 , TRP B:53 , ARG B:131 , SER B:139 , TYR B:194 , THR B:228 , SER B:229 , PHE B:230 , MET B:233 , PHE B:256 , MET B:257 , ARG B:258 , LYS B:259 , GLY B:260	BINDING SITE FOR RESIDUE A3P B 601

(no "SS Bond" information available for 3CKL)

Asymmetric Unit

No.	Residues
1	Ser A:102	-	Pro A:103
2	Ser B:102	-	Pro B:103

(no "SAP(SNP)/Variant" information available for 3CKL)

(no "PROSITE Motif" information available for 3CKL)

Asymmetric Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3a	ENST00000310613	3a	ENSE00001180398	chr4:70626430-70626177	254	ST1B1_HUMAN	-	0	0	-	-
1.5a	ENST00000310613	5a	ENSE00001180407	chr4:70620979-70620788	192	ST1B1_HUMAN	1-50	50	2	A:6-50 B:1-50	45 50
1.6	ENST00000310613	6	ENSE00002155316	chr4:70620516-70620388	129	ST1B1_HUMAN	50-93	44	2	A:50-93 (gaps) B:50-93	44 44
1.7	ENST00000310613	7	ENSE00001180389	chr4:70615536-70615439	98	ST1B1_HUMAN	93-125	33	2	A:93-125 B:93-125	33 33
1.8b	ENST00000310613	8b	ENSE00001180385	chr4:70599982-70599856	127	ST1B1_HUMAN	126-168	43	2	A:126-168 B:126-168	43 43
1.9	ENST00000310613	9	ENSE00001180380	chr4:70599225-70599131	95	ST1B1_HUMAN	168-199	32	2	A:168-199 B:168-199	32 32
1.10	ENST00000310613	10	ENSE00001180373	chr4:70596399-70596219	181	ST1B1_HUMAN	200-260	61	2	A:200-260 B:200-260	61 61
1.11	ENST00000310613	11	ENSE00001239171	chr4:70592918-70592566	353	ST1B1_HUMAN	260-296	37	2	A:260-296 B:260-296	37 37

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:289
 aligned with ST1B1_HUMAN | O43704 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:291
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295 
          ST1B1_HUMAN     6 DILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI 296
               SCOP domains d3ckla_ A: automated matches                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 3cklA00 A:6-296 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                                CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eee..eeehhhhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhh..hhhhhh..hhhhhh.......-.-..hhhhhhhhh....eeee.......hhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.....hhhhhhhhhhhh.....eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh...........................hhhhhh.hhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: A:6-50 UniProt: 1-50         ------------------------------------------Exon 1.7  PDB: A:93-125          Exon 1.8b  PDB: A:126-168 UniProt: 126-168 -------------------------------Exon 1.10  PDB: A:200-260 UniProt: 200-260                   ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------Exon 1.6  PDB: A:50-93 (gaps) UniProt: 50-93--------------------------------------------------------------------------Exon 1.9  PDB: A:168-199        ------------------------------------------------------------Exon 1.11  PDB: A:260-296             Transcript 1 (2)
                 3ckl A   6 DILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTL-G-RTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI 296
                                    15        25        35        45        55        65        75        85| | |   95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295 
                                                                                                           86 | |                                                                                                                                                                                                              
                                                                                                             88 |                                                                                                                                                                                                              
                                                                                                               90

Chain B from PDB  Type:PROTEIN  Length:296
 aligned with ST1B1_HUMAN | O43704 from UniProtKB/Swiss-Prot  Length:296

    Alignment length:296
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290      
          ST1B1_HUMAN     1 MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI 296
               SCOP domains d3cklb_ B: automated matches                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains 3cklB00 B:1-296 P-loop containing nucleotide triphosphate hydrolases                                                                                                                                                                                                                                     CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............eee..eeehhhhh.hhhhhhh.......eeeee....hhhhhhhhhhhhhh....hhhhh.hhhhhh............hhhhhhhhh....eeee.......hhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.......hhhhhhhhhhh......hhhhhhhhhhhhh....eeeeehhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh............................hhhhhh.hhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: B:1-50 UniProt: 1-50              ------------------------------------------Exon 1.7  PDB: B:93-125          Exon 1.8b  PDB: B:126-168 UniProt: 126-168 -------------------------------Exon 1.10  PDB: B:200-260 UniProt: 200-260                   ------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------Exon 1.6  PDB: B:50-93 UniProt: 50-93       --------------------------------------------------------------------------Exon 1.9  PDB: B:168-199        ------------------------------------------------------------Exon 1.11  PDB: B:260-296             Transcript 1 (2)
                 3ckl B   1 MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI 296
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: P-loop containing nucleoside triphosphate hydrolases (2083)

Superfamily: P-loop containing nucleoside triphosphate hydrolases (2083)

Family: PAPS sulfotransferase (54)

Protein domain: automated matches (23)

Human (Homo sapiens) [TaxId: 9606] (11)

1a	d3ckla_	A:
1b	d3cklb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: P-loop containing nucleotide triphosphate hydrolases (1378)

Human (Homo sapiens) (413)

1a	3cklA00	A:6-296
1b	3cklB00	B:1-296

(no "Pfam Domain" information available for 3CKL)

Asymmetric Unit(hide GO term definitions)

Chain A,B (ST1B1_HUMAN | O43704)

molecular function
	GO:0004062	aryl sulfotransferase activity	Catalysis of the reaction: 3'-phosphoadenosine 5'-phosphosulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008146	sulfotransferase activity	Catalysis of the transfer of a sulfate group from 3'-phosphoadenosine 5'-phosphosulfate to the hydroxyl group of an acceptor, producing the sulfated derivative and 3'-phosphoadenosine 5'-phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0050427	3'-phosphoadenosine 5'-phosphosulfate metabolic process	The chemical reactions and pathways involving 3'-phosphoadenosine 5'-phosphosulfate, a naturally occurring mixed anhydride. It is an intermediate in the formation of a variety of sulfo compounds in biological systems.
	GO:0006576	cellular biogenic amine metabolic process	The chemical reactions and pathways occurring at the level of individual cells involving any of a group of naturally occurring, biologically active amines, such as norepinephrine, histamine, and serotonin, many of which act as neurotransmitters.
	GO:0030855	epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
	GO:0009812	flavonoid metabolic process	The chemical reactions and pathways involving flavonoids, a group of water-soluble phenolic derivatives containing a flavan skeleton including flavones, flavonols and flavanoids, and anthocyanins.
	GO:0006629	lipid metabolic process	The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
	GO:0018958	phenol-containing compound metabolic process	The chemical reactions and pathways involving a phenol, any compound containing one or more hydroxyl groups directly attached to an aromatic carbon ring.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0051923	sulfation	The addition of a sulfate group to a molecule.
	GO:0042403	thyroid hormone metabolic process	The chemical reactions and pathways involving any of the compounds secreted by the thyroid gland, largely thyroxine and triiodothyronine.
	GO:0006805	xenobiotic metabolic process	The chemical reactions and pathways involving a xenobiotic compound, a compound foreign to living organisms. Used of chemical compounds, e.g. a xenobiotic chemical, such as a pesticide.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		A3P	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		STL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser A:102 - Pro A:103	[ RasMol ]
		Ser B:102 - Pro B:103	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3ckl
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ST1B1_HUMAN \| O43704
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.8.2.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ST1B1_HUMAN \| O43704
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ST1B1_HUMAN \| O43704	:	2z5f

(no "Related Entries Specified in the PDB File" available for 3CKL)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File