|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric/Biological Unit (3, 3) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3CEC) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3CEC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3CEC) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3CEC) |
Exons (0, 0)| (no "Exon" information available for 3CEC) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:91 aligned with D0VWT6_NOSP7 | D0VWT6 from UniProtKB/TrEMBL Length:104 Alignment length:91 23 33 43 53 63 73 83 93 103 D0VWT6_NOSP7 14 VRPIHPGEVIADILDDLDINTANFAEILGVSNQTIQEVINGQRSITVDIAIRLGKALGNGPRLWLNLQQKVDLWYALQSHKEEYEQVMTLV 104 SCOP domains ------------------------------------------------------------------------------------------- SCOP domains CATH domains 3cecA00 A:13-103 lambda repressor-like DNA-binding domains CATH domains Pfam domains ------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------- Transcript 3cec A 13 VRPIHPGEVIADILDDLDINTANFAEILGVSNQTIQEVINGQRSITVDIAIRLGKALGNGPRLWLNLQQKVDLWYALQSHKEEYEQVmTLV 103 22 32 42 52 62 72 82 92 102 100-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3CEC) |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3CEC) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (D0VWT6_NOSP7 | D0VWT6)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|