Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF REGULATORY PROTEIN TETR FROM RHODOBACTER SPHAEROIDES
 
Authors :  J. Osipiuk, N. Maltseva, L. Freeman, A. Joachimiak, Midwest Center F Structural Genomics (Mcsg)
Date :  21 Dec 07  (Deposition) - 08 Jan 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Apc88928, Tetr, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Dna- Binding, Transcription, Transcription Regulation (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Osipiuk, N. Maltseva, L. Freeman, A. Joachimiak
Crystal Structure Of Regulatory Protein Tetr From Rhodobacter Sphaeroides.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - REGULATORY PROTEIN, TETR FAMILY
    Atcc17023
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPMCSG7
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneRSP_1435, RHOS4_00080
    Organism ScientificRHODOBACTER SPHAEROIDES 2.4.1
    Organism Taxid272943
    Strain2.4.1 / NCIB 8253 / DSM 158

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3BRU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3BRU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3BRU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3BRU)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HTH_TETR_2PS50977 TetR-type HTH domain profile.ACUR_RHOS426-86
 
  2A:26-86
B:26-86

(-) Exons   (0, 0)

(no "Exon" information available for 3BRU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:191
 aligned with ACUR_RHOS4 | Q3J6K8 from UniProtKB/Swiss-Prot  Length:219

    Alignment length:191
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213 
           ACUR_RHOS4    24 DASLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLARLRLFTRMAEEGMARHGFRRGCLVGNLGQEMGALPDDFRAALIGVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHFV 214
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3bruA00 A:24-214 Tetracycline Repressor, domain 2                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --HTH_TETR_2  PDB: A:26-86 UniProt: 26-86                      -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3bru A  24 DASLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLARLRLFTRmAEEGmARHGFRRGCLVGNLGQEmGALPDDFRAALIGVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHFV 214
                                    33        43        53        63        73        83        93       103       113  |    123       133|      143       153       163       173       183       193       203       213 
                                                                                                                 111-MSE|               134-MSE                                                                            
                                                                                                                      116-MSE                                                                                              

Chain B from PDB  Type:PROTEIN  Length:189
 aligned with ACUR_RHOS4 | Q3J6K8 from UniProtKB/Swiss-Prot  Length:219

    Alignment length:189
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205         
           ACUR_RHOS4    26 SLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLARLRLFTRMAEEGMARHGFRRGCLVGNLGQEMGALPDDFRAALIGVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHFV 214
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3bruB00 B:26-214 Tetracycline Repressor, domain 2                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE HTH_TETR_2  PDB: B:26-86 UniProt: 26-86                      -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3bru B  26 SLAHQSLIRAGLEHLTEKGYSSVGVDEILKAARVPKGSFYHYFRNKADFGLALIEAYDTYFARLLDQAFLDGSLAPLARLRLFTRmAEEGmARHGFRRGCLVGNLGQEmGALPDDFRAALIGVLETWQRRTAQLFREAQACGELSADHDPDALAEAFWIGWEGAILRAKLELRPDPLHSFTRTFGRHFV 214
                                    35        45        55        65        75        85        95       105     | 115|      125       135       145       155       165       175       185       195       205         
                                                                                                               111-MSE|               134-MSE                                                                            
                                                                                                                    116-MSE                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3BRU)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3BRU)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (ACUR_RHOS4 | Q3J6K8)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3bru)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3bru)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3bru
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACUR_RHOS4 | Q3J6K8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ACUR_RHOS4 | Q3J6K8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3BRU)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3BRU)