|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3BJO) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3BJO) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3BJO) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3BJO) |
Exons (0, 0)| (no "Exon" information available for 3BJO) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:103 aligned with Y1010_METJA | Q58416 from UniProtKB/Swiss-Prot Length:377 Alignment length:103 284 294 304 314 324 334 344 354 364 374 Y1010_METJA 275 HKNLKDVLNILLMDEISKLKDFLSNLDYIKPKVNIEEEIIEIRKEDIINALKLFKGKYEIEVDKIPKAVYVYLVKKNILFLYPQRGTLKPQSFLVWNAIKRVL 377 SCOP domains ------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 3bjoA00 A:-2-100 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 3bjo A -2 SNALKDVLNILLmDEISKLKDFLSNLDYIKPKVNIEEEIIEIRKEDIINALKLFKGKYEIEVDKIPKAVYVYLVKKNILFLYPQRGTLKPQSFLVWNAIKRVL 100 7 | 17 27 37 47 57 67 77 87 97 10-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3BJO) |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3BJO) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Y1010_METJA | Q58416)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|