Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
(-)Biological Unit 5
(-)Biological Unit 6
(-)Biological Unit 7
(-)Biological Unit 8
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)
Image Biological Unit 5
Biological Unit 5  (Jmol Viewer)
Image Biological Unit 6
Biological Unit 6  (Jmol Viewer)
Image Biological Unit 7
Biological Unit 7  (Jmol Viewer)
Image Biological Unit 8
Biological Unit 8  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN Q6D8G1 AT THE RESOLUTION 1.9 A. NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET EWR22A.
 
Authors :  A. P. Kuzin, M. Su, J. Seetharaman, D. Wang, Y. Fang, K. Cunningham, L. Owens, R. Xiao, J. Liu, M. C. Baran, T. B. Acton, B. Rost, G. T. Montelione, J. F. Hunt, L. Tong, Northeast Structural Genomics Consortium (Nesg)
Date :  15 Nov 07  (Deposition) - 27 Nov 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C,D,E,F,G
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A,B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  B,D  (1x)
Biol. Unit 5:  C,E  (1x)
Biol. Unit 6:  D,F  (1x)
Biol. Unit 7:  E,G  (1x)
Biol. Unit 8:  A,B,C,D,E,F,G  (1x)
Keywords :  X_ray, Nesg, Q6D8G1, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Lipoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. P. Kuzin, M. Su, J. Seetharaman, D. Wang, Y. Fang, K. Cunningham, L. Owens, R. Xiao, J. Liu, M. C. Baran, T. B. Acton, B. Rost, G. T. Montelione, J. F. Hunt, L. Tong
Crystal Structure Of Protein Q6D8G1 At The Resolution 1. 9 A.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PUTATIVE LIPOPROTEIN
    AtccBAA-672
    ChainsA, B, C, D, E, F, G
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    FragmentRESIDUES 21-73
    GeneECA1013
    Organism ScientificPECTOBACTERIUM ATROSEPTICUM SCRI1043
    Organism Taxid218491
    StrainSCRI 1043

 Structural Features

(-) Chains, Units

  1234567
Asymmetric Unit ABCDEFG
Biological Unit 1 (1x)A      
Biological Unit 2 (1x)AB     
Biological Unit 3 (1x)  C    
Biological Unit 4 (1x) B D   
Biological Unit 5 (1x)  C E  
Biological Unit 6 (1x)   D F 
Biological Unit 7 (1x)    E G
Biological Unit 8 (1x)ABCDEFG

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 14)

Asymmetric Unit (1, 14)
No.NameCountTypeFull Name
1MSE14Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE
Biological Unit 4 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 5 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 6 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 7 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 8 (1, 14)
No.NameCountTypeFull Name
1MSE14Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 3BDU)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3BDU)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3BDU)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3BDU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3BDU)

(-) Exons   (0, 0)

(no "Exon" information available for 3BDU)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:53
 aligned with Q6D8G1_PECAS | Q6D8G1 from UniProtKB/TrEMBL  Length:73

    Alignment length:53
                                    30        40        50        60        70   
          Q6D8G1_PECAS   21 SSNYVLHTNDGRTIVAEGKPKVDDETGMISYTDAYGQQQQINRDNVKEMAKGK 73
               SCOP domains d3bdua1 A:2-54 Uncharacterized protein ECA1013        SCOP domains
               CATH domains 3bduA00 A:2-54  [code=2.30.30.100, no name defined]   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeee...ee......eeee.....eeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------- Transcript
                  3bdu A  2 SSNYVLHTNDGRTIVAEGKPKVDDETGmISYTDAYGQQQQINRDNVKEmAKGK 54
                                    11        21       |31        41        51   
                                                      29-MSE               50-MSE

Chain B from PDB  Type:PROTEIN  Length:52
 aligned with Q6D8G1_PECAS | Q6D8G1 from UniProtKB/TrEMBL  Length:73

    Alignment length:52
                                    30        40        50        60        70  
          Q6D8G1_PECAS   21 SSNYVLHTNDGRTIVAEGKPKVDDETGMISYTDAYGQQQQINRDNVKEMAKG 72
               SCOP domains d3bdub_ B: Uncharacterized protein ECA1013           SCOP domains
               CATH domains 3bduB00 B:2-53  [code=2.30.30.100, no name defined]  CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeee...ee......eeee.....eeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------- Transcript
                  3bdu B  2 SSNYVLHTNDGRTIVAEGKPKVDDETGmISYTDAYGQQQQINRDNVKEmAKG 53
                                    11        21       |31        41        51  
                                                      29-MSE               50-MSE

Chain C from PDB  Type:PROTEIN  Length:52
 aligned with Q6D8G1_PECAS | Q6D8G1 from UniProtKB/TrEMBL  Length:73

    Alignment length:52
                                    30        40        50        60        70  
          Q6D8G1_PECAS   21 SSNYVLHTNDGRTIVAEGKPKVDDETGMISYTDAYGQQQQINRDNVKEMAKG 72
               SCOP domains d3bduc_ C: Uncharacterized protein ECA1013           SCOP domains
               CATH domains 3bduC00 C:2-53  [code=2.30.30.100, no name defined]  CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeee...ee......eeee.....eeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------- Transcript
                  3bdu C  2 SSNYVLHTNDGRTIVAEGKPKVDDETGmISYTDAYGQQQQINRDNVKEmAKG 53
                                    11        21       |31        41        51  
                                                      29-MSE               50-MSE

Chain D from PDB  Type:PROTEIN  Length:52
 aligned with Q6D8G1_PECAS | Q6D8G1 from UniProtKB/TrEMBL  Length:73

    Alignment length:52
                                    30        40        50        60        70  
          Q6D8G1_PECAS   21 SSNYVLHTNDGRTIVAEGKPKVDDETGMISYTDAYGQQQQINRDNVKEMAKG 72
               SCOP domains d3bdud_ D: Uncharacterized protein ECA1013           SCOP domains
               CATH domains 3bduD00 D:2-53  [code=2.30.30.100, no name defined]  CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee....eeee....ee......eeee.....eeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------- Transcript
                  3bdu D  2 SSNYVLHTNDGRTIVAEGKPKVDDETGmISYTDAYGQQQQINRDNVKEmAKG 53
                                    11        21       |31        41        51  
                                                      29-MSE               50-MSE

Chain E from PDB  Type:PROTEIN  Length:53
 aligned with Q6D8G1_PECAS | Q6D8G1 from UniProtKB/TrEMBL  Length:73

    Alignment length:53
                                    30        40        50        60        70   
          Q6D8G1_PECAS   21 SSNYVLHTNDGRTIVAEGKPKVDDETGMISYTDAYGQQQQINRDNVKEMAKGK 73
               SCOP domains d3bdue_ E: Uncharacterized protein ECA1013            SCOP domains
               CATH domains 3bduE00 E:2-54  [code=2.30.30.100, no name defined]   CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee....eeee....ee......eeee.....eeee....eeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------- Transcript
                  3bdu E  2 SSNYVLHTNDGRTIVAEGKPKVDDETGmISYTDAYGQQQQINRDNVKEmAKGK 54
                                    11        21       |31        41        51   
                                                      29-MSE               50-MSE

Chain F from PDB  Type:PROTEIN  Length:52
 aligned with Q6D8G1_PECAS | Q6D8G1 from UniProtKB/TrEMBL  Length:73

    Alignment length:52
                                    30        40        50        60        70  
          Q6D8G1_PECAS   21 SSNYVLHTNDGRTIVAEGKPKVDDETGMISYTDAYGQQQQINRDNVKEMAKG 72
               SCOP domains d3bduf_ F: Uncharacterized protein ECA1013           SCOP domains
               CATH domains 3bduF00 F:2-53  [code=2.30.30.100, no name defined]  CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee....eeee....ee......eeee.....eeee....eeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------- Transcript
                  3bdu F  2 SSNYVLHTNDGRTIVAEGKPKVDDETGmISYTDAYGQQQQINRDNVKEmAKG 53
                                    11        21       |31        41        51  
                                                      29-MSE               50-MSE

Chain G from PDB  Type:PROTEIN  Length:52
 aligned with Q6D8G1_PECAS | Q6D8G1 from UniProtKB/TrEMBL  Length:73

    Alignment length:52
                                    30        40        50        60        70  
          Q6D8G1_PECAS   21 SSNYVLHTNDGRTIVAEGKPKVDDETGMISYTDAYGQQQQINRDNVKEMAKG 72
               SCOP domains d3bdug_ G: Uncharacterized protein ECA1013           SCOP domains
               CATH domains 3bduG00 G:2-53  [code=2.30.30.100, no name defined]  CATH domains
               Pfam domains ---------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee....eeeee...ee......eeee.....eeee....eeeeeee Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------- Transcript
                  3bdu G  2 SSNYVLHTNDGRTIVAEGKPKVDDETGmISYTDAYGQQQQINRDNVKEmAKG 53
                                    11        21       |31        41        51  
                                                      29-MSE               50-MSE

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 7)

Asymmetric Unit

(-) CATH Domains  (1, 7)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3BDU)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 3BDU)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3bdu)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3bdu)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]
    Biological Unit 5  [ Jena3D ]
    Biological Unit 6  [ Jena3D ]
    Biological Unit 7  [ Jena3D ]
    Biological Unit 8  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3bdu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6D8G1_PECAS | Q6D8G1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q6D8G1_PECAS | Q6D8G1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 3BDU)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3BDU)