Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE ERBB4 KINASE
 
Authors :  C. Qiu
Date :  12 Nov 07  (Deposition) - 12 Feb 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Active Conformation, Atp-Binding, Glycoprotein, Kinase, Membrane, Nucleotide-Binding, Phosphorylation, Receptor, Transferase, Transmembrane, Tyrosine-Protein Kinase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Qiu, M. K. Tarrant, S. H. Choi, A. Sathyamurthy, R. Bose, S. Banjade, A. Pal, W. G. Bornmann, M. A. Lemmon, P. A. Cole, D. J. Leahy
Mechanism Of Activation And Inhibition Of The Her4/Erbb4 Kinase.
Structure V. 16 460 2008
PubMed-ID: 18334220  |  Reference-DOI: 10.1016/J.STR.2007.12.016

(-) Compounds

Molecule 1 - RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    ChainsA, B, C
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System PlasmidPFASTBAC
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentERBB4 KINASE DOMAIN (UNP RESIDUES 702-1029)
    GeneERBB4, HER4
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymP180ERBB4, TYROSINE KINASE-TYPE CELL SURFACE RECEPTOR HER4

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit ABC
Biological Unit 1 (1x)A  
Biological Unit 2 (1x) B 
Biological Unit 3 (1x)  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric Unit (3, 3)
No.NameCountTypeFull Name
1MN1Ligand/IonMANGANESE (II) ION
2PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
3PG41Ligand/IonTETRAETHYLENE GLYCOL
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1MN-1Ligand/IonMANGANESE (II) ION
2PEG-1Ligand/IonDI(HYDROXYETHYL)ETHER
3PG4-1Ligand/IonTETRAETHYLENE GLYCOL
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1MN-1Ligand/IonMANGANESE (II) ION
2PEG-1Ligand/IonDI(HYDROXYETHYL)ETHER
3PG4-1Ligand/IonTETRAETHYLENE GLYCOL
Biological Unit 3 (2, 2)
No.NameCountTypeFull Name
1MN-1Ligand/IonMANGANESE (II) ION
2PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
3PG41Ligand/IonTETRAETHYLENE GLYCOL

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR A:901 , THR C:901BINDING SITE FOR RESIDUE MN A 1
2AC2SOFTWAREGLN C:793 , ASN C:797 , ASN C:830BINDING SITE FOR RESIDUE PG4 C 502
3AC3SOFTWAREMET C:747 , VAL C:756 , THR C:771 , GLN C:772 , MET C:774 , LEU C:825 , THR C:835BINDING SITE FOR RESIDUE PEG C 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3BCE)

(-) Cis Peptide Bonds  (5, 5)

Asymmetric Unit
No.Residues
1Glu A:715 -Gly A:716
2Leu A:759 -Gly A:760
3Ser A:764 -Pro A:765
4Ser B:764 -Pro B:765
5Ser C:764 -Pro C:765

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 3)

Asymmetric Unit (1, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_070810R927QERBB4_HUMANDisease (ALS19)397514262A/B/CR902Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_070810R927QERBB4_HUMANDisease (ALS19)397514262AR902Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_070810R927QERBB4_HUMANDisease (ALS19)397514262BR902Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_070810R927QERBB4_HUMANDisease (ALS19)397514262CR902Q

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 6)

Asymmetric Unit (2, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.ERBB4_HUMAN724-751
 
 
  3A:699-726
B:699-726
C:699-726
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.ERBB4_HUMAN839-851
 
 
  3A:814-826
B:814-826
C:814-826
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.ERBB4_HUMAN724-751
 
 
  1A:699-726
-
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.ERBB4_HUMAN839-851
 
 
  1A:814-826
-
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.ERBB4_HUMAN724-751
 
 
  1-
B:699-726
-
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.ERBB4_HUMAN839-851
 
 
  1-
B:814-826
-
Biological Unit 3 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PROTEIN_KINASE_ATPPS00107 Protein kinases ATP-binding region signature.ERBB4_HUMAN724-751
 
 
  1-
-
C:699-726
2PROTEIN_KINASE_TYRPS00109 Tyrosine protein kinases specific active-site signature.ERBB4_HUMAN839-851
 
 
  1-
-
C:814-826

(-) Exons   (8, 24)

Asymmetric Unit (8, 24)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000003427881aENSE00001557570chr2:213403565-213403173393ERBB4_HUMAN1-28280--
1.4aENST000003427884aENSE00001771678chr2:212989628-212989477152ERBB4_HUMAN28-78510--
1.6ENST000003427886ENSE00001307932chr2:212812341-212812155187ERBB4_HUMAN79-141630--
1.7ENST000003427887ENSE00001330200chr2:212652884-212652750135ERBB4_HUMAN141-186460--
1.8bENST000003427888bENSE00001309248chr2:212615429-21261536466ERBB4_HUMAN186-208230--
1.9bENST000003427889bENSE00001231844chr2:212589919-212589801119ERBB4_HUMAN208-247400--
1.10ENST0000034278810ENSE00001231830chr2:212587259-212587118142ERBB4_HUMAN248-295480--
1.11ENST0000034278811ENSE00001231825chr2:212578373-212578260114ERBB4_HUMAN295-333390--
1.12ENST0000034278812ENSE00001231820chr2:212576901-212576775127ERBB4_HUMAN333-375430--
1.13ENST0000034278813ENSE00001231810chr2:212570116-21257004374ERBB4_HUMAN375-400260--
1.14ENST0000034278814ENSE00001231802chr2:212568919-21256882991ERBB4_HUMAN400-430310--
1.15ENST0000034278815ENSE00001231837chr2:212566891-212566692200ERBB4_HUMAN430-497680--
1.16ENST0000034278816ENSE00001289675chr2:212543909-212543777133ERBB4_HUMAN497-541450--
1.17ENST0000034278817ENSE00001314199chr2:212537982-21253788994ERBB4_HUMAN541-572320--
1.18aENST0000034278818aENSE00001309289chr2:212530202-212530048155ERBB4_HUMAN573-624520--
1.20aENST0000034278820aENSE00001312803chr2:212522553-21252247975ERBB4_HUMAN624-649260--
1.21ENST0000034278821ENSE00001310742chr2:212495319-212495187133ERBB4_HUMAN649-693450--
1.22ENST0000034278822ENSE00001318394chr2:212488769-212488647123ERBB4_HUMAN694-734413A:678-709
B:678-709
C:678-709
32
32
32
1.23bENST0000034278823bENSE00001318884chr2:212484000-21248390299ERBB4_HUMAN735-767333A:710-742 (gaps)
B:710-742 (gaps)
C:710-742
33
33
33
1.24aENST0000034278824aENSE00001295501chr2:212426813-212426628186ERBB4_HUMAN768-829623A:743-804
B:743-804
C:743-804
62
62
62
1.25ENST0000034278825ENSE00001002880chr2:212295825-212295670156ERBB4_HUMAN830-881523A:805-856 (gaps)
B:805-856 (gaps)
C:805-856 (gaps)
52
52
52
1.26ENST0000034278826ENSE00000965161chr2:212293208-21229313376ERBB4_HUMAN882-907263A:857-882
B:857-882
C:857-882
26
26
26
1.27ENST0000034278827ENSE00000965162chr2:212289026-212288880147ERBB4_HUMAN907-956503A:882-931
B:882-931
C:882-931
50
50
50
1.28ENST0000034278828ENSE00001002882chr2:212286829-21228673298ERBB4_HUMAN956-988333A:931-963
B:931-963
C:931-963
33
33
33
1.29ENST0000034278829ENSE00001002878chr2:212285336-212285166171ERBB4_HUMAN989-1045573A:964-966
B:964-968
C:964-965
3
5
2
1.30ENST0000034278830ENSE00001329579chr2:212252717-21225267048ERBB4_HUMAN1046-1061160--
1.31ENST0000034278831ENSE00001302849chr2:212251875-212251578298ERBB4_HUMAN1062-11611000--
1.32bENST0000034278832bENSE00001330493chr2:212248785-2122404468340ERBB4_HUMAN1161-13081480--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:285
 aligned with ERBB4_HUMAN | Q15303 from UniProtKB/Swiss-Prot  Length:1308

    Alignment length:289
                                   712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982         
          ERBB4_HUMAN   703 TAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 991
               SCOP domains d3bcea_ A: automated matches                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 3bceA01 A:678-773 Phosphorylase Kinase; domain 1                                                3bceA02 A:774-966 Transferase(Phosphotransferase) domain 1                                                                                                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eehhh.eeeeeeee.....eeeeeee........eeeeeee....--.hhhhhhhhhhhhhhh........eeeee.....eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee..eeee......ee.......ee.--...hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------PROTEIN_KINASE_ATP          ---------------------------------------------------------------------------------------PROTEIN_KINAS-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.22  PDB: A:678-709       Exon 1.23b  PDB: A:710-742 (gaps)Exon 1.24a  PDB: A:743-804 UniProt: 768-829                   Exon 1.25  PDB: A:805-856 (gaps) UniProt: 830-881   Exon 1.26  PDB: A:857-882 ------------------------------------------------Exon 1.28  PDB: A:931-963        1.2 Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.27  PDB: A:882-931 UniProt: 907-956        ----------------------------------- Transcript 1 (2)
                 3bce A 678 TAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNET--PKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNA--GKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD 966
                                   687       697       707       717       727   |  |737       747       757       767       777       787       797       807       817       827       837       847    |  857       867       877       887       897       907       917       927       937       947       957         
                                                                               731  |                                                                                                                   852  |                                                                                                               
                                                                                  734                                                                                                                      855                                                                                                               

Chain B from PDB  Type:PROTEIN  Length:286
 aligned with ERBB4_HUMAN | Q15303 from UniProtKB/Swiss-Prot  Length:1308

    Alignment length:291
                                   712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992 
          ERBB4_HUMAN   703 TAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRM 993
               SCOP domains d3bceb_ B: automated matches                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 3bceB01 B:678-773 Phosphorylase Kinase; domain 1                                                3bceB02 B:774-968 Transferase(Phosphotransferase) domain 1                                                                                                                                          CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eehhh.eeeeeeeeee..eeeeeeee........eeeeeee....---hhhhhhhhhhhhhhh........eeeee.....eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee..eeee......ee..........--...hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhh...hhhhh.hhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------PROTEIN_KINASE_ATP          ---------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.22  PDB: B:678-709       Exon 1.23b  PDB: B:710-742 (gaps)Exon 1.24a  PDB: B:743-804 UniProt: 768-829                   Exon 1.25  PDB: B:805-856 (gaps) UniProt: 830-881   Exon 1.26  PDB: B:857-882 ------------------------------------------------Exon 1.28  PDB: B:931-963        1.29  Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.27  PDB: B:882-931 UniProt: 907-956        ------------------------------------- Transcript 1 (2)
                 3bce B 678 TAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNET---KANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNA--GKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRM 968
                                   687       697       707       717       727   |   737       747       757       767       777       787       797       807       817       827       837       847    |  857       867       877       887       897       907       917       927       937       947       957       967 
                                                                               731 735                                                                                                                  852  |                                                                                                                 
                                                                                                                                                                                                           855                                                                                                                 

Chain C from PDB  Type:PROTEIN  Length:286
 aligned with ERBB4_HUMAN | Q15303 from UniProtKB/Swiss-Prot  Length:1308

    Alignment length:288
                                   712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982        
          ERBB4_HUMAN   703 TAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGD 990
               SCOP domains d3bcec_ C: automated matches                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 3bceC01 C:678-773 Phosphorylase Kinase; domain 1                                                3bceC02 C:774-965 Transferase(Phosphotransferase) domain 1                                                                                                                                       CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .........eehhh.eeeeeeeeee..eeeeeeee........eeeeeee.......hhhhhhhhhhhhhhh........eeeee.....eeeee.....hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee..eeee......ee..-....ee..-...hhhhhhhhhhhhheehhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhh...hhhhh.hhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q--------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------PROTEIN_KINASE_ATP          ---------------------------------------------------------------------------------------PROTEIN_KINAS------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.22  PDB: C:678-709       Exon 1.23b  PDB: C:710-742       Exon 1.24a  PDB: C:743-804 UniProt: 768-829                   Exon 1.25  PDB: C:805-856 (gaps) UniProt: 830-881   Exon 1.26  PDB: C:857-882 ------------------------------------------------Exon 1.28  PDB: C:931-963        1. Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.27  PDB: C:882-931 UniProt: 907-956        ---------------------------------- Transcript 1 (2)
                 3bce C 678 TAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLE-DEKEYNAD-GKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGD 965
                                   687       697       707       717       727       737       747       757       767       777       787       797       807       817       827       837      |847     | 857       867       877       887       897       907       917       927       937       947       957        
                                                                                                                                                                                                844 |    853 |                                                                                                              
                                                                                                                                                                                                  846      855                                                                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (2, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3BCE)

(-) Gene Ontology  (69, 69)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (ERBB4_HUMAN | Q15303)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0005088    Ras guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0005154    epidermal growth factor receptor binding    Interacting selectively and non-covalently with the epidermal growth factor receptor.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0046934    phosphatidylinositol-4,5-bisphosphate 3-kinase activity    Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0004672    protein kinase activity    Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
    GO:0004713    protein tyrosine kinase activity    Catalysis of the reaction: ATP + a protein tyrosine = ADP + protein tyrosine phosphate.
    GO:0004716    signal transducer, downstream of receptor, with protein tyrosine kinase activity    Conveys a signal from an upstream receptor or intracellular signal transducer by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0004714    transmembrane receptor protein tyrosine kinase activity    Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: ATP + a protein-L-tyrosine = ADP + a protein-L-tyrosine phosphate.
biological process
    GO:0038128    ERBB2 signaling pathway    A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
    GO:0000165    MAPK cascade    An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0061026    cardiac muscle tissue regeneration    The regrowth of cardiac muscle tissue to repair injured or damaged muscle fibers in the postnatal stage.
    GO:0045165    cell fate commitment    The commitment of cells to specific cell fates and their capacity to differentiate into particular kinds of cells. Positional information is established through protein signals that emanate from a localized source within a cell (the initial one-cell zygote) or within a developmental field.
    GO:0016477    cell migration    The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
    GO:0008283    cell proliferation    The multiplication or reproduction of cells, resulting in the expansion of a cell population.
    GO:0021551    central nervous system morphogenesis    The process in which the anatomical structure of the central nervous system is generated and organized. The central nervous system is the core nervous system that serves an integrating and coordinating function. In vertebrates it consists of the brain and spinal cord. In those invertebrates with a central nervous system it typically consists of a brain, cerebral ganglia and a nerve cord.
    GO:0009880    embryonic pattern specification    The process that results in the patterns of cell differentiation that will arise in an embryo.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0007595    lactation    The regulated release of milk from the mammary glands and the period of time that a mother lactates to feed her young.
    GO:0060749    mammary gland alveolus development    The progression of the mammary gland alveolus over time, from its formation to its mature state. The mammary gland alveolus is a sac-like structure that is found in the mature gland.
    GO:0060644    mammary gland epithelial cell differentiation    The process in which a relatively unspecialized epithelial cell becomes a more specialized epithelial cell of the mammary gland.
    GO:0043653    mitochondrial fragmentation involved in apoptotic process    The change in the morphology of the mitochondria in an apoptotic cell from a highly branched network to a fragmented vesicular form.
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:2001223    negative regulation of neuron migration    Any process that stops, prevents or reduces the frequency, rate or extent of neuron migration.
    GO:0007399    nervous system development    The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
    GO:0001755    neural crest cell migration    The characteristic movement of cells from the dorsal ridge of the neural tube to a variety of locations in a vertebrate embryo.
    GO:0021889    olfactory bulb interneuron differentiation    The process in which a neuroblast acquires specialized features of an interneuron residing in the olfactory bulb.
    GO:0018108    peptidyl-tyrosine phosphorylation    The phosphorylation of peptidyl-tyrosine to form peptidyl-O4'-phospho-L-tyrosine.
    GO:0046854    phosphatidylinositol phosphorylation    The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
    GO:0048015    phosphatidylinositol-mediated signaling    A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0070374    positive regulation of ERK1 and ERK2 cascade    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the ERK1 and ERK2 cascade.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:2000366    positive regulation of STAT protein import into nucleus    Any process that activates or increases the frequency, rate or extent of STAT protein import into nucleus.
    GO:0060045    positive regulation of cardiac muscle cell proliferation    Any process that activates or increases the frequency, rate or extent of cardiac muscle cell proliferation.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0043552    positive regulation of phosphatidylinositol 3-kinase activity    Any process that activates or increases the frequency, rate or extent of phosphatidylinositol 3-kinase activity.
    GO:0014068    positive regulation of phosphatidylinositol 3-kinase signaling    Any process that activates or increases the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:2000010    positive regulation of protein localization to cell surface    Any process that activates or increases the frequency, rate or extent of protein localization to the cell surface.
    GO:0001934    positive regulation of protein phosphorylation    Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0046777    protein autophosphorylation    The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
    GO:0006468    protein phosphorylation    The process of introducing a phosphate group on to a protein.
    GO:0030334    regulation of cell migration    Any process that modulates the frequency, rate or extent of cell migration.
    GO:2000145    regulation of cell motility    Any process that modulates the frequency, rate or extent of cell motility.
    GO:0014066    regulation of phosphatidylinositol 3-kinase signaling    Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0007169    transmembrane receptor protein tyrosine kinase signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PG4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:715 - Gly A:716   [ RasMol ]  
    Leu A:759 - Gly A:760   [ RasMol ]  
    Ser A:764 - Pro A:765   [ RasMol ]  
    Ser B:764 - Pro B:765   [ RasMol ]  
    Ser C:764 - Pro C:765   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3bce
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ERBB4_HUMAN | Q15303
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  615515
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ERBB4_HUMAN | Q15303
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ERBB4_HUMAN | Q153032ahx 2l2t 2lcx 2r4b 3bbt 3bbw 3u2p 3u7u 3u9u

(-) Related Entries Specified in the PDB File

3bbt 3bbw