Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  FGD1 (RV0407) FROM MYCOBACTERIUM TUBERCULOSIS
 
Authors :  G. Bashiri, C. J. Squire, N. M. Moreland, E. N. Baker, Tb Structural Ge Consortium (Tbsgc)
Date :  25 Oct 07  (Deposition) - 22 Apr 08  (Release) - 18 May 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.95
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Tim-Barrel, Non-Prolyl Cis-Peptide Bulge, F420 Binding, Oxidoreductase, Structural Genomics, Tb Structural Genomics Consortium, Tbsgc (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Bashiri, C. J. Squire, N. J. Moreland, E. N. Baker
Crystal Structures Of F420-Dependent Glucose-6-Phosphate Dehydrogenase Fgd1 Involved In The Activation Of The Anti-Tuberculosis Drug Candidate Pa-824 Reveal The Basis Of Coenzyme And Substrate Binding
J. Biol. Chem. V. 283 17531 2008
PubMed-ID: 18434308  |  Reference-DOI: 10.1074/JBC.M801854200

(-) Compounds

Molecule 1 - PROBABLE F420-DEPENDENT GLUCOSE-6-PHOSPHATE DEHYDROGENASE FGD1
    ChainsA, B
    EC Number1.-.-.-
    EngineeredYES
    Expression SystemMYCOBACTERIUM SMEGMATIS
    Expression System PlasmidPYUB1049
    Expression System StrainMC2 4517
    Expression System Taxid1772
    Expression System Vector TypePLASMID
    GeneRV0407
    MutationYES
    Organism ScientificMYCOBACTERIUM TUBERCULOSIS H37RV
    Organism Taxid83332
    StrainH37-RV
    SynonymGLUCOSE-6-PHOSPHATE DEHYDROGENASE, F420-DEPENDENT

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 22)

Asymmetric/Biological Unit (4, 22)
No.NameCountTypeFull Name
1CSO2Mod. Amino AcidS-HYDROXYCYSTEINE
2F422Ligand/IonCOENZYME F420
3FLC2Ligand/IonCITRATE ANION
4MSE16Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:38 , ASP A:39 , HIS A:40 , SER A:73 , VAL A:74 , THR A:76 , GLY A:106 , THR A:107 , GLY A:108 , GLU A:109 , ASN A:112 , PHE A:125 , ALA A:175 , ALA A:176 , GLY A:177 , GLY A:178 , PRO A:179 , ALA A:180 , VAL A:181 , THR A:195 , GLU A:230 , HIS A:260 , FLC A:337 , HOH A:339 , HOH A:341 , HOH A:368 , HOH A:402BINDING SITE FOR RESIDUE F42 A 338
2AC2SOFTWARETRP A:44 , GLU A:109 , THR A:195 , LYS A:198 , LYS A:232 , LEU A:252 , LYS A:259 , HIS A:260 , ARG A:283 , F42 A:338 , HOH A:368 , HOH A:411 , HOH A:424BINDING SITE FOR RESIDUE FLC A 337
3AC3SOFTWARESER B:38 , ASP B:39 , HIS B:40 , SER B:73 , VAL B:74 , THR B:76 , GLY B:106 , THR B:107 , GLY B:108 , GLU B:109 , ASN B:112 , PHE B:125 , ALA B:175 , ALA B:176 , GLY B:177 , GLY B:178 , PRO B:179 , ALA B:180 , VAL B:181 , THR B:195 , GLU B:230 , HIS B:260 , FLC B:337 , HOH B:345 , HOH B:351 , HOH B:355 , HOH B:358 , HOH B:360 , HOH B:425BINDING SITE FOR RESIDUE F42 B 338
4AC4SOFTWARETRP B:44 , GLU B:109 , THR B:195 , LYS B:198 , LYS B:232 , LEU B:252 , LYS B:259 , HIS B:260 , ARG B:283 , F42 B:338 , HOH B:346 , HOH B:358 , HOH B:403BINDING SITE FOR RESIDUE FLC B 337

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3B4Y)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ser A:73 -Val A:74
2Ser B:73 -Val B:74

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3B4Y)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3B4Y)

(-) Exons   (0, 0)

(no "Exon" information available for 3B4Y)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:332
 aligned with FGD_MYCTO | P9WNE0 from UniProtKB/Swiss-Prot  Length:336

    Alignment length:332
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332  
            FGD_MYCTO     3 ELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR 334
               SCOP domains d3b4ya_ A: automated matches                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 3b4yA00 A:3-334 FMN dependent fluorescent proteins                                                                                                                                                                                                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....hhhhhhhhhhhhhhh...eeee...............hhhhhhhhhhhhh...eeee.........hhhhhhhhhhhhhhhh...eeeee...hhhhhh.........hhhhhhhhhhhhhhhhhhhhh...eeee....eeeee...........eeee..hhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhhhhh.......eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh..hhhhhhhhheee.hhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3b4y A   3 ELKLGYKASAEQFAPRELVELAVAAEAHGmDSATVSDHFQPWRHQGGHAPFSLSWmTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATmGcLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLmRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLmPAVREGAAAADRSVDGIDKmIEIKISYDPDPELAmNNTRFWAPLSLTAEQKHSIDDPIEmEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR 334
                                    12        22        32        42        52     |  62        72        82        92| |    102       112       122       132      |142       152       162       172       182       192       202     | 212       222     | 232       242|      252       262     | 272       282       292       302       312       322       332  
                                                        32-MSE                    58-MSE                             93-MSE                                       139-MSE                                                              208-MSE             228-MSE        243-MSE                  268-MSE                                                              
                                                                                                                       95-CSO                                                                                                                                                                                                                                           

Chain A from PDB  Type:PROTEIN  Length:332
 aligned with FGD_MYCTU | P9WNE1 from UniProtKB/Swiss-Prot  Length:336

    Alignment length:332
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332  
            FGD_MYCTU     3 ELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR 334
               SCOP domains d3b4ya_ A: automated matches                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 3b4yA00 A:3-334 FMN dependent fluorescent proteins                                                                                                                                                                                                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....hhhhhhhhhhhhhhh...eeee...............hhhhhhhhhhhhh...eeee.........hhhhhhhhhhhhhhhh...eeeee...hhhhhh.........hhhhhhhhhhhhhhhhhhhhh...eeee....eeeee...........eeee..hhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhhhhh.......eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh..hhhhhhhhheee.hhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3b4y A   3 ELKLGYKASAEQFAPRELVELAVAAEAHGmDSATVSDHFQPWRHQGGHAPFSLSWmTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATmGcLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLmRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLmPAVREGAAAADRSVDGIDKmIEIKISYDPDPELAmNNTRFWAPLSLTAEQKHSIDDPIEmEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR 334
                                    12        22        32        42        52     |  62        72        82        92| |    102       112       122       132      |142       152       162       172       182       192       202     | 212       222     | 232       242|      252       262     | 272       282       292       302       312       322       332  
                                                        32-MSE                    58-MSE                             93-MSE                                       139-MSE                                                              208-MSE             228-MSE        243-MSE                  268-MSE                                                              
                                                                                                                       95-CSO                                                                                                                                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:332
 aligned with FGD_MYCTO | P9WNE0 from UniProtKB/Swiss-Prot  Length:336

    Alignment length:332
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332  
            FGD_MYCTO     3 ELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR 334
               SCOP domains d3b4yb_ B: automated matches                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 3b4yB00 B:3-334 FMN dependent fluorescent proteins                                                                                                                                                                                                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....hhhhhhhhhhhhhhh...eeee...............hhhhhhhhhhhhh...eeee.........hhhhhhhhhhhhhhhh...eeeee...hhhhhh.........hhhhhhhhhhhhhhhhhhhhh...eeee....eeeee...........eeee..hhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhhhhh.......eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhh..eee.hhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3b4y B   3 ELKLGYKASAEQFAPRELVELAVAAEAHGmDSATVSDHFQPWRHQGGHAPFSLSWmTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATmGcLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLmRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLmPAVREGAAAADRSVDGIDKmIEIKISYDPDPELAmNNTRFWAPLSLTAEQKHSIDDPIEmEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR 334
                                    12        22        32        42        52     |  62        72        82        92| |    102       112       122       132      |142       152       162       172       182       192       202     | 212       222     | 232       242|      252       262     | 272       282       292       302       312       322       332  
                                                        32-MSE                    58-MSE                             93-MSE                                       139-MSE                                                              208-MSE             228-MSE        243-MSE                  268-MSE                                                              
                                                                                                                       95-CSO                                                                                                                                                                                                                                           

Chain B from PDB  Type:PROTEIN  Length:332
 aligned with FGD_MYCTU | P9WNE1 from UniProtKB/Swiss-Prot  Length:336

    Alignment length:332
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332  
            FGD_MYCTU     3 ELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHQGGHAPFSLSWMTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATMGCLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLMRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLMPAVREGAAAADRSVDGIDKMIEIKISYDPDPELALNNTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR 334
               SCOP domains d3b4yb_ B: automated matches                                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 3b4yB00 B:3-334 FMN dependent fluorescent proteins                                                                                                                                                                                                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....hhhhhhhhhhhhhhh...eeee...............hhhhhhhhhhhhh...eeee.........hhhhhhhhhhhhhhhh...eeeee...hhhhhh.........hhhhhhhhhhhhhhhhhhhhh...eeee....eeeee...........eeee..hhhhhhhhhhhh.eeeee...hhhhhhhhhhhhhhhhhhhh.......eeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhh..eee.hhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3b4y B   3 ELKLGYKASAEQFAPRELVELAVAAEAHGmDSATVSDHFQPWRHQGGHAPFSLSWmTAVGERTNRLLLGTSVLTPTFRYNPAVIAQAFATmGcLYPNRVFLGVGTGEALNEIATGYEGAWPEFKERFARLRESVGLmRQLWSGDRVDFDGDYYRLKGASIYDVPDGGVPVYIAAGGPAVAKYAGRAGDGFICTSGKGEELYTEKLmPAVREGAAAADRSVDGIDKmIEIKISYDPDPELAmNNTRFWAPLSLTAEQKHSIDDPIEmEKAADALPIEQIAKRWIVASDPDEAVEKVGQYVTWGLNHLVFHAPGHDQRRFLELFQSDLAPRLRR 334
                                    12        22        32        42        52     |  62        72        82        92| |    102       112       122       132      |142       152       162       172       182       192       202     | 212       222     | 232       242|      252       262     | 272       282       292       302       312       322       332  
                                                        32-MSE                    58-MSE                             93-MSE                                       139-MSE                                                              208-MSE             228-MSE        243-MSE                  268-MSE                                                              
                                                                                                                       95-CSO                                                                                                                                                                                                                                           

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3B4Y)

(-) Gene Ontology  (12, 19)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (FGD_MYCTO | P9WNE0)
molecular function
    GO:0070967    coenzyme F420 binding    Interacting selectively and non-covalently with F420, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0052749    glucose-6-phosphate dehydrogenase (coenzyme F420) activity    Catalysis of the reaction: beta-D-glucose 6-phosphate + coenzyme F420 + H+ = 6-O-phosphono-D-glucono-1,5-lactone + reduced coenzyme F420.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016614    oxidoreductase activity, acting on CH-OH group of donors    Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group act as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
    GO:0016705    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen    Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain A,B   (FGD_MYCTU | P9WNE1)
molecular function
    GO:0070967    coenzyme F420 binding    Interacting selectively and non-covalently with F420, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0052749    glucose-6-phosphate dehydrogenase (coenzyme F420) activity    Catalysis of the reaction: beta-D-glucose 6-phosphate + coenzyme F420 + H+ = 6-O-phosphono-D-glucono-1,5-lactone + reduced coenzyme F420.
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016614    oxidoreductase activity, acting on CH-OH group of donors    Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group act as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
    GO:0016705    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen    Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
biological process
    GO:0005975    carbohydrate metabolic process    The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
    GO:0045454    cell redox homeostasis    Any process that maintains the redox environment of a cell or compartment within a cell.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0005618    cell wall    The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CSO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    F42  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ser A:73 - Val A:74   [ RasMol ]  
    Ser B:73 - Val B:74   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3b4y
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FGD_MYCTO | P9WNE0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FGD_MYCTU | P9WNE1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.-.-.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FGD_MYCTO | P9WNE0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FGD_MYCTU | P9WNE1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FGD_MYCTO | P9WNE03c8n
        FGD_MYCTU | P9WNE13c8n

(-) Related Entries Specified in the PDB File

3c8n APO-FGD1 RELATED ID: RV0407 RELATED DB: TARGETDB