Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  PVHL54-213-ELOB-ELOC COMPLEX _ (2S,4R)-N-((1,1'-BIPHENYL)-4-YLMETHYL)-4-HYDROXY-1-(2-(3-METHYLISOXAZOL-5-YL)ACETYL) PYRROLIDINE-2-CARBOXAMIDE
 
Authors :  I. Vanmolle, D. L. Buckley, C. M. Crews, A. Ciulli
Date :  06 Jul 11  (Deposition) - 25 Jul 12  (Release) - 14 Nov 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.65
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Biol. Unit 3:  G,H,I  (1x)
Biol. Unit 4:  J,K,L  (1x)
Keywords :  Transcription, Tumour Supressor Protein, Chronic Aneamia Treatment, E3 Ubiquitin Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Van Molle, A. Thomann, D. L. Buckley, E. C. So, S. Lang, C. M. Crews, A. Ciulli
Dissecting Fragment-Based Lead Discovery At The Von Hippel- Lindau Protein:Hypoxia Inducible Factor 1Alpha Protein- Protein Interface.
Chem. Biol. V. 19 1300 2012
PubMed-ID: 23102223  |  Reference-DOI: 10.1016/J.CHEMBIOL.2012.08.015

(-) Compounds

Molecule 1 - TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 2
    ChainsA, D, G, J
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPCDF-DUET1
    Expression System Vector TypePLASMID
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymELONGIN 18 KDA SUBUNIT, ELONGIN-B, ELOB, RNA POLYMERASE II TRANSCRIPTION FACTOR SIII SUBUNIT B, SIII P18, ELONGINB
 
Molecule 2 - TRANSCRIPTION ELONGATION FACTOR B POLYPEPTIDE 1
    ChainsB, E, H, K
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPCDF-DUET1
    Expression System Vector TypePLASMID
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymELONGIN 15 KDA SUBUNIT, ELONGIN-C, ELOC, RNA POLYMERASE II TRANSCRIPTION FACTOR SIII SUBUNIT C, SIII P15, ELONGINC
 
Molecule 3 - VON HIPPEL-LINDAU DISEASE TUMOR SUPPRESSOR
    ChainsC, F, I, L
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System VectorPET28A
    Expression System Vector TypePLASMID
    FragmentRESIDUES 54-213
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROTEIN G7, PVHL

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit ABCDEFGHIJKL
Biological Unit 1 (1x)ABC         
Biological Unit 2 (1x)   DEF      
Biological Unit 3 (1x)      GHI   
Biological Unit 4 (1x)         JKL

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1TR04Ligand/Ion(4R)-N-(BIPHENYL-4-YLMETHYL)-4-HYDROXY-1-[(3-METHYLISOXAZOL-5-YL)ACETYL]-L-PROLINAMIDE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1TR01Ligand/Ion(4R)-N-(BIPHENYL-4-YLMETHYL)-4-HYDROXY-1-[(3-METHYLISOXAZOL-5-YL)ACETYL]-L-PROLINAMIDE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1TR01Ligand/Ion(4R)-N-(BIPHENYL-4-YLMETHYL)-4-HYDROXY-1-[(3-METHYLISOXAZOL-5-YL)ACETYL]-L-PROLINAMIDE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1TR01Ligand/Ion(4R)-N-(BIPHENYL-4-YLMETHYL)-4-HYDROXY-1-[(3-METHYLISOXAZOL-5-YL)ACETYL]-L-PROLINAMIDE
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1TR01Ligand/Ion(4R)-N-(BIPHENYL-4-YLMETHYL)-4-HYDROXY-1-[(3-METHYLISOXAZOL-5-YL)ACETYL]-L-PROLINAMIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP I:88 , PHE I:91 , TYR I:98 , PRO I:99 , ILE I:109 , HIS I:110 , SER I:111 , TYR I:112 , HIS I:115 , TRP I:117 , HOH I:2001 , HOH I:2002BINDING SITE FOR RESIDUE TR0 I1207
2AC2SOFTWARETRP C:88 , TYR C:98 , PRO C:99 , ILE C:109 , HIS C:110 , SER C:111 , TYR C:112 , HIS C:115 , TRP C:117 , HOH C:2001 , ARG L:182BINDING SITE FOR RESIDUE TR0 C1205
3AC3SOFTWARETRP F:88 , PHE F:91 , TYR F:98 , PRO F:99 , ARG F:107 , ILE F:109 , HIS F:110 , SER F:111 , TYR F:112 , HIS F:115 , TRP F:117 , HOH F:2002BINDING SITE FOR RESIDUE TR0 F1205
4AC4SOFTWARETRP L:88 , PHE L:91 , TYR L:98 , PRO L:99 , ILE L:109 , HIS L:110 , SER L:111 , TYR L:112 , HIS L:115 , TRP L:117 , HOH L:2002 , HOH L:2001BINDING SITE FOR RESIDUE TR0 L1205

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3ZTC)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Glu D:98 -Leu D:99
2Asp F:143 -Gly F:144
3Asp G:82 -Asp G:83
4Asp J:83 -Thr J:84

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (120, 480)

Asymmetric Unit (120, 480)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827C/F/I/LL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826C/F/I/LR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616C/F/I/LS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826C/F/I/LS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826C/F/I/LS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---C/F/I/LS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802C/F/I/LE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803C/F/I/LV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---C/F/I/LF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---C/F/I/LF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033C/F/I/LF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---C/F/I/LN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804C/F/I/LN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---C/F/I/LN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---C/F/I/LR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805C/F/I/LS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805C/F/I/LS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---C/F/I/LS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806C/F/I/LP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890C/F/I/LR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827C/F/I/LV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481C/F/I/LP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---C/F/I/LP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034C/F/I/LP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---C/F/I/LP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481C/F/I/LP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---C/F/I/LW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277C/F/I/LW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807C/F/I/LL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807C/F/I/LL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---C/F/I/LF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808C/F/I/LG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---C/F/I/LG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808C/F/I/LG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---C/F/I/LQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809C/F/I/LY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---C/F/I/LL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---C/F/I/LL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---C/F/I/LG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---C/F/I/LT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---C/F/I/LG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440C/F/I/LR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609C/F/I/LR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706C/F/I/LH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---C/F/I/LS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631C/F/I/LS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945C/F/I/LS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824C/F/I/LY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824C/F/I/LY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---C/F/I/LG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636C/F/I/LG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---C/F/I/LG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---C/F/I/LH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812C/F/I/LH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811C/F/I/LH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---C/F/I/LL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215C/F/I/LW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830C/F/I/LL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---C/F/I/LL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---C/F/I/LF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---C/F/I/LF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832C/F/I/LD121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---C/F/I/LA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831C/F/I/LD126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---C/F/I/LL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830C/F/I/LV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---C/F/I/LN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---C/F/I/LN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278C/F/I/LL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833C/F/I/LF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833C/F/I/LF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---C/F/I/LF136Y
073UniProtVAR_005738D143EVHL_HUMANDisease (VHLD)  ---C/F/I/LD143E
074UniProtVAR_008100Q145HVHL_HUMANDisease (VHLD)771727849C/F/I/LQ145H
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---C/F/I/LI147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077C/F/I/LA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---C/F/I/LP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---C/F/I/LV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659C/F/I/LV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441C/F/I/LY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---C/F/I/LY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---C/F/I/LY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660C/F/I/LT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346C/F/I/LL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---C/F/I/LL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---C/F/I/LK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818C/F/I/LR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---C/F/I/LR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035C/F/I/LR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444C/F/I/LC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---C/F/I/LC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622C/F/I/LC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---C/F/I/LC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297C/F/I/LL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---C/F/I/LQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170C/F/I/LQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---C/F/I/LV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825C/F/I/LV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820C/F/I/LR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821C/F/I/LR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820C/F/I/LR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---C/F/I/LV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---C/F/I/LV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---C/F/I/LV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---C/F/I/LY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---C/F/I/LR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---C/F/I/LL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822C/F/I/LL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747C/F/I/LI180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---C/F/I/LL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---C/F/I/LL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984C/F/I/LE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---C/F/I/LL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---C/F/I/LL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824C/F/I/LL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301C/F/I/LH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300C/F/I/LP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---C/F/I/LL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---C/F/I/LL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298C/F/I/LR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (120, 120)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827CL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826CR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616CS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826CS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826CS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---CS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802CE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803CV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---CF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---CF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033CF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---CN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804CN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---CN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---CR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805CS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805CS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---CS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806CP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890CR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827CV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481CP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---CP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034CP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---CP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481CP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---CW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277CW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807CL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807CL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---CF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808CG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---CG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808CG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---CQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809CY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---CL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---CL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---CG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---CT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---CG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440CR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609CR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706CH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---CS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631CS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945CS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824CY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824CY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---CG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636CG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---CG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---CH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812CH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811CH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---CL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215CW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830CL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---CL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---CF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---CF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832CD121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---CA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831CD126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---CL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830CV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---CN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---CN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278CL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833CF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833CF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---CF136Y
073UniProtVAR_005738D143EVHL_HUMANDisease (VHLD)  ---CD143E
074UniProtVAR_008100Q145HVHL_HUMANDisease (VHLD)771727849CQ145H
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---CI147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077CA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---CP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---CV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659CV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441CY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---CY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---CY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660CT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346CL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---CL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---CK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818CR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---CR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035CR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444CC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---CC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622CC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---CC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297CL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---CQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170CQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---CV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825CV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820CR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821CR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820CR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---CV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---CV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---CV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---CY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---CR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---CL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822CL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747CI180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---CL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---CL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984CE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---CL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---CL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824CL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301CH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300CP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---CL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---CL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298CR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (120, 120)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827FL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826FR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616FS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826FS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826FS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---FS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802FE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803FV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---FF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---FF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033FF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---FN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804FN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---FN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---FR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805FS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805FS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---FS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806FP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890FR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827FV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481FP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---FP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034FP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---FP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481FP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---FW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277FW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807FL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807FL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---FF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808FG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---FG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808FG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---FQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809FY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---FL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---FL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---FG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---FT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---FG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440FR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609FR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706FH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---FS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631FS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945FS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824FY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824FY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---FG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636FG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---FG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---FH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812FH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811FH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---FL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215FW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830FL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---FL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---FF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---FF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832FD121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---FA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831FD126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---FL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830FV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---FN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---FN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278FL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833FF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833FF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---FF136Y
073UniProtVAR_005738D143EVHL_HUMANDisease (VHLD)  ---FD143E
074UniProtVAR_008100Q145HVHL_HUMANDisease (VHLD)771727849FQ145H
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---FI147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077FA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---FP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---FV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659FV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441FY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---FY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---FY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660FT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346FL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---FL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---FK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818FR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---FR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035FR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444FC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---FC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622FC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---FC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297FL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---FQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170FQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---FV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825FV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820FR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821FR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820FR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---FV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---FV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---FV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---FY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---FR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---FL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822FL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747FI180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---FL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---FL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984FE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---FL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---FL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824FL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301FH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300FP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---FL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---FL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298FR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 3 (120, 120)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827IL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826IR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616IS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826IS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826IS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---IS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802IE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803IV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---IF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---IF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033IF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---IN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804IN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---IN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---IR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805IS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805IS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---IS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806IP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890IR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827IV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481IP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---IP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034IP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---IP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481IP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---IW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277IW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807IL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807IL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---IF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808IG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---IG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808IG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---IQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809IY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---IL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---IL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---IG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---IT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---IG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440IR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609IR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706IH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---IS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631IS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945IS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824IY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824IY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---IG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636IG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---IG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---IH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812IH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811IH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---IL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215IW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830IL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---IL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---IF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---IF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832ID121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---IA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831ID126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---IL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830IV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---IN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---IN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278IL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833IF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833IF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---IF136Y
073UniProtVAR_005738D143EVHL_HUMANDisease (VHLD)  ---ID143E
074UniProtVAR_008100Q145HVHL_HUMANDisease (VHLD)771727849IQ145H
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---II147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077IA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---IP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---IV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659IV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441IY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---IY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---IY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660IT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346IL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---IL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---IK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818IR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---IR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035IR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444IC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---IC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622IC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---IC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297IL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---IQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170IQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---IV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825IV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820IR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821IR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820IR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---IV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---IV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---IV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---IY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---IR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---IL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822IL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747II180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---IL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---IL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984IE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---IL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---IL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824IL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301IH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300IP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---IL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---IL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298IR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 4 (120, 120)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_034987L63PVHL_HUMANDisease (PCC)104893827LL63P
002UniProtVAR_034988R64PVHL_HUMANDisease (PCC)104893826LR64P
003UniProtVAR_034989S65AVHL_HUMANDisease (PCC)869025616LS65A
004UniProtVAR_005672S65LVHL_HUMANDisease (VHLD)5030826LS65L
005UniProtVAR_005673S65WVHL_HUMANDisease (VHLD)5030826LS65W
006UniProtVAR_005675S68WVHL_HUMANDisease (VHLD)  ---LS68W
007UniProtVAR_005676E70KVHL_HUMANDisease (VHLD)5030802LE70K
008UniProtVAR_005677V74GVHL_HUMANDisease (VHLD)5030803LV74G
009UniProtVAR_005679F76IVHL_HUMANDisease (VHLD)  ---LF76I
010UniProtVAR_005680F76LVHL_HUMANDisease (VHLD)  ---LF76L
011UniProtVAR_005681F76SVHL_HUMANDisease (VHLD)730882033LF76S
012UniProtVAR_005682N78HVHL_HUMANDisease (VHLD)  ---LN78H
013UniProtVAR_005683N78SVHL_HUMANDisease (VHLD)5030804LN78S
014UniProtVAR_005684N78TVHL_HUMANDisease (VHLD)  ---LN78T
015UniProtVAR_005685R79PVHL_HUMANDisease (VHLD)  ---LR79P
016UniProtVAR_005686S80IVHL_HUMANDisease (VHLD)5030805LS80I
017UniProtVAR_005688S80NVHL_HUMANDisease (VHLD)5030805LS80N
018UniProtVAR_005687S80RVHL_HUMANDisease (VHLD)  ---LS80R
019UniProtVAR_005689P81SVHL_HUMANDisease (VHLD)5030806LP81S
020UniProtVAR_005690R82PVHL_HUMANDisease (VHLD)794726890LR82P
021UniProtVAR_005692V84LVHL_HUMANDisease (VHLD)5030827LV84L
022UniProtVAR_005693P86AVHL_HUMANDisease (VHLD)398123481LP86A
023UniProtVAR_008097P86HVHL_HUMANDisease (VHLD)  ---LP86H
024UniProtVAR_005694P86LVHL_HUMANDisease (VHLD)730882034LP86L
025UniProtVAR_005695P86RVHL_HUMANDisease (VHLD)  ---LP86R
026UniProtVAR_005696P86SVHL_HUMANDisease (VHLD)398123481LP86S
027UniProtVAR_005697W88RVHL_HUMANDisease (VHLD)  ---LW88R
028UniProtVAR_005698W88SVHL_HUMANDisease (VHLD)119103277LW88S
029UniProtVAR_005699L89HVHL_HUMANUnclassified5030807LL89H
030UniProtVAR_005700L89PVHL_HUMANDisease (VHLD)5030807LL89P
031UniProtVAR_005701F91LVHL_HUMANUnclassified  ---LF91L
032UniProtVAR_005703G93CVHL_HUMANDisease (VHLD)5030808LG93C
033UniProtVAR_005704G93DVHL_HUMANDisease (VHLD)  ---LG93D
034UniProtVAR_005705G93SVHL_HUMANDisease (VHLD)5030808LG93S
035UniProtVAR_005706Q96PVHL_HUMANDisease (VHLD)  ---LQ96P
036UniProtVAR_005707Y98HVHL_HUMANDisease (VHLD)5030809LY98H
037UniProtVAR_005708L101GVHL_HUMANDisease (VHLD)  ---LL101G
038UniProtVAR_005709L101RVHL_HUMANDisease (VHLD)  ---LL101R
039UniProtVAR_005710G104AVHL_HUMANUnclassified  ---LG104A
040UniProtVAR_005711T105PVHL_HUMANDisease (VHLD)  ---LT105P
041UniProtVAR_005712G106DVHL_HUMANUnclassified  ---LG106D
042UniProtVAR_034991R107GVHL_HUMANDisease (PCC)397516440LR107G
043UniProtVAR_005713R107PVHL_HUMANDisease (VHLD)193922609LR107P
044UniProtVAR_055087H110YVHL_HUMANPolymorphism17855706LH110Y
045UniProtVAR_005714S111CVHL_HUMANDisease (VHLD)  ---LS111C
046UniProtVAR_005715S111NVHL_HUMANDisease (VHLD)869025631LS111N
047UniProtVAR_005716S111RVHL_HUMANDisease (VHLD)765978945LS111R
048UniProtVAR_005717Y112HVHL_HUMANDisease (VHLD)104893824LY112H
049UniProtVAR_034992Y112NVHL_HUMANDisease (VHLD)104893824LY112N
050UniProtVAR_005718G114CVHL_HUMANDisease (VHLD)  ---LG114C
051UniProtVAR_005719G114RVHL_HUMANDisease (VHLD)869025636LG114R
052UniProtVAR_005720G114SVHL_HUMANDisease (VHLD)  ---LG114S
053UniProtVAR_005723H115QVHL_HUMANDisease (VHLD)  ---LH115Q
054UniProtVAR_008098H115RVHL_HUMANDisease (VHLD)5030812LH115R
055UniProtVAR_005722H115YVHL_HUMANDisease (VHLD)5030811LH115Y
056UniProtVAR_005724L116VVHL_HUMANDisease (VHLD)  ---LL116V
057UniProtVAR_005725W117CVHL_HUMANDisease (VHLD)727504215LW117C
058UniProtVAR_005726L118PVHL_HUMANDisease (VHLD)5030830LL118P
059UniProtVAR_005727L118RVHL_HUMANDisease (VHLD)  ---LL118R
060UniProtVAR_005728F119LVHL_HUMANDisease (VHLD)  ---LF119L
061UniProtVAR_005729F119SVHL_HUMANDisease (VHLD)  ---LF119S
062UniProtVAR_005730D121GVHL_HUMANDisease (VHLD)5030832LD121G
063UniProtVAR_034993A122IVHL_HUMANDisease (PCC)  ---LA122I
064UniProtVAR_034994D126YVHL_HUMANDisease (ECYT2)104893831LD126Y
065UniProtVAR_005731L128FVHL_HUMANDisease (VHLD)  ---LL128F
066UniProtVAR_005733V130LVHL_HUMANDisease (VHLD)104893830LV130L
067UniProtVAR_005734N131KVHL_HUMANDisease (VHLD)  ---LN131K
068UniProtVAR_005735N131TVHL_HUMANDisease (VHLD)  ---LN131T
069UniProtVAR_034995L135FVHL_HUMANPolymorphism119103278LL135F
070UniProtVAR_005737F136CVHL_HUMANDisease (VHLD)5030833LF136C
071UniProtVAR_005736F136SVHL_HUMANDisease (VHLD)5030833LF136S
072UniProtVAR_008099F136YVHL_HUMANDisease (VHLD)  ---LF136Y
073UniProtVAR_005738D143EVHL_HUMANDisease (VHLD)  ---LD143E
074UniProtVAR_008100Q145HVHL_HUMANDisease (VHLD)771727849LQ145H
075UniProtVAR_034996I147TVHL_HUMANDisease (PCC)  ---LI147T
076UniProtVAR_005740A149TVHL_HUMANDisease (VHLD)587780077LA149T
077UniProtVAR_005741P154LVHL_HUMANDisease (VHLD)  ---LP154L
078UniProtVAR_005742V155GVHL_HUMANDisease (VHLD)  ---LV155G
079UniProtVAR_008101V155MVHL_HUMANDisease (VHLD)869025659LV155M
080UniProtVAR_005743Y156CVHL_HUMANDisease (VHLD)397516441LY156C
081UniProtVAR_005744Y156DVHL_HUMANDisease (VHLD)  ---LY156D
082UniProtVAR_034997Y156NVHL_HUMANDisease (PCC)  ---LY156N
083UniProtVAR_005746T157IVHL_HUMANDisease (VHLD)869025660LT157I
084UniProtVAR_005748L158PVHL_HUMANDisease (VHLD)121913346LL158P
085UniProtVAR_005749L158VVHL_HUMANDisease (VHLD)  ---LL158V
086UniProtVAR_005750K159EVHL_HUMANDisease (VHLD)  ---LK159E
087UniProtVAR_005753R161GVHL_HUMANDisease (VHLD)5030818LR161G
088UniProtVAR_005752R161PVHL_HUMANDisease (VHLD)  ---LR161P
089UniProtVAR_005751R161QVHL_HUMANDisease (VHLD)730882035LR161Q
090UniProtVAR_005754C162FVHL_HUMANDisease (VHLD)397516444LC162F
091UniProtVAR_005755C162RVHL_HUMANDisease (VHLD)  ---LC162R
092UniProtVAR_005756C162WVHL_HUMANDisease (VHLD)5030622LC162W
093UniProtVAR_005757C162YVHL_HUMANDisease (VHLD)  ---LC162Y
094UniProtVAR_034998L163PVHL_HUMANDisease (RCC)28940297LL163P
095UniProtVAR_008102Q164HVHL_HUMANDisease (VHLD)  ---LQ164H
096UniProtVAR_005758Q164RVHL_HUMANDisease (VHLD)267607170LQ164R
097UniProtVAR_008103V166DVHL_HUMANDisease (VHLD)  ---LV166D
098UniProtVAR_005759V166FVHL_HUMANDisease (VHLD)104893825LV166F
099UniProtVAR_005760R167GVHL_HUMANDisease (VHLD)5030820LR167G
100UniProtVAR_005761R167QVHL_HUMANDisease (VHLD)5030821LR167Q
101UniProtVAR_005762R167WVHL_HUMANDisease (VHLD)5030820LR167W
102UniProtVAR_005763V170DVHL_HUMANDisease (VHLD)  ---LV170D
103UniProtVAR_005764V170FVHL_HUMANDisease (VHLD)  ---LV170F
104UniProtVAR_005765V170GVHL_HUMANDisease (VHLD)  ---LV170G
105UniProtVAR_005766Y175DVHL_HUMANDisease (VHLD)  ---LY175D
106UniProtVAR_008104R176WVHL_HUMANDisease (VHLD)  ---LR176W
107UniProtVAR_005768L178PVHL_HUMANDisease (VHLD)  ---LL178P
108UniProtVAR_005769L178QVHL_HUMANDisease (VHLD)5030822LL178Q
109UniProtVAR_005770I180VVHL_HUMANDisease (VHLD)377715747LI180V
110UniProtVAR_005772L184PVHL_HUMANDisease (VHLD)  ---LL184P
111UniProtVAR_005771L184RVHL_HUMANDisease (VHLD)  ---LL184R
112UniProtVAR_005773E186KVHL_HUMANDisease (VHLD)367545984LE186K
113UniProtVAR_005775L188PVHL_HUMANDisease (VHLD)  ---LL188P
114UniProtVAR_005776L188QVHL_HUMANDisease (VHLD)  ---LL188Q
115UniProtVAR_005777L188VVHL_HUMANDisease (VHLD)5030824LL188V
116UniProtVAR_034999H191DVHL_HUMANDisease (ECYT2)28940301LH191D
117UniProtVAR_035000P192SVHL_HUMANDisease (ECYT2)28940300LP192S
118UniProtVAR_035001L198QVHL_HUMANDisease (PCC)  ---LL198Q
119UniProtVAR_005778L198RVHL_HUMANDisease (VHLD)  ---LL198R
120UniProtVAR_005779R200WVHL_HUMANDisease (VHLD)28940298LR200W

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  4A:1-66
D:1-66
G:1-66
J:1-66
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  1A:1-66
-
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  1-
D:1-66
-
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  1-
-
G:1-66
-
Biological Unit 4 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1UBIQUITIN_2PS50053 Ubiquitin domain profile.ELOB_HUMAN1-66
 
 
 
  1-
-
-
J:1-66

(-) Exons   (5, 20)

Asymmetric Unit (5, 20)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1aENST000002564741aENSE00001930974chr3:10182692-101838711180VHL_HUMAN1-1141144C:63-114
F:63-114
I:62-114
L:62-114
52
52
53
53
1.4ENST000002564744ENSE00001163994chr3:10188198-10188320123VHL_HUMAN114-155424C:114-155 (gaps)
F:114-155
I:114-155
L:114-155
42
42
42
42
1.6dENST000002564746dENSE00001814424chr3:10191471-101939042434VHL_HUMAN155-213594C:155-204
F:155-204
I:155-206
L:155-204
50
50
52
50

2.1gENST000002848111gENSE00002103151chr8:74884341-7488427765ELOC_HUMAN-00--
2.6ENST000002848116ENSE00001087342chr8:74872053-7487200054ELOC_HUMAN1-220--
2.7ENST000002848117ENSE00001016720chr8:74868289-74868146144ELOC_HUMAN2-50494B:17-47
E:17-48
H:17-48
K:17-48
31
32
32
32
2.10dENST0000028481110dENSE00001424822chr8:74859055-74858636420ELOC_HUMAN50-112634B:58-112
E:58-112
H:58-112 (gaps)
K:58-112
55
55
55
55

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:103
 aligned with ELOB_HUMAN | Q15370 from UniProtKB/Swiss-Prot  Length:118

    Alignment length:104
                                    10        20        30        40        50        60        70        80        90       100    
           ELOB_HUMAN     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK 104
               SCOP domains d3ztca_ A: Elongin B                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeeee...hhhhhhhhhhhhhh.hhh.eeeee..ee.....hhhhhh...........eeeeeee..-...................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBIQUITIN_2  PDB: A:1-66 UniProt: 1-66                            -------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 3ztc A   1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRA-DTFEALCIEPFSSPPELPDVMK 104
                                    10        20        30        40        50        60        70        80| |     90       100    
                                                                                                           81 |                     
                                                                                                             83                     

Chain B from PDB  Type:PROTEIN  Length:86
 aligned with ELOC_HUMAN | Q15369 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:96
                                    26        36        46        56        66        76        86        96       106      
           ELOC_HUMAN    17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
               SCOP domains d3ztcb_ B: Elongin C                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeeehhhhh.hhhhhhhh.----------.eee....hhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) ---------------------------------Exon 2.10d  PDB: B:58-112 UniProt: 50-112 [INCOMPLETE]          Transcript 2 (1)
           Transcript 2 (2) Exon 2.7  PDB: B:17-47            -------------------------------------------------------------- Transcript 2 (2)
                 3ztc B  17 MYVKLISSDGHEFIVKREHALTSGTIKAMLS----------NEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
                                    26        36        46|        - |      66        76        86        96       106      
                                                         47         58                                                      

Chain C from PDB  Type:PROTEIN  Length:141
 aligned with VHL_HUMAN | P40337 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:142
                                    72        82        92       102       112       122       132       142       152       162       172       182       192       202  
            VHL_HUMAN    63 LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE 204
               SCOP domains d3ztcc_ C: automated matches                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeee.....eeeeee.....eee........eeeeeee...eeeeee.......ee...........-....eeeeee....hhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhh..hhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) PPA--W-K---G-I-HPISP-L-A-RH-L-C--P-H--G--APDG--YCH-CQVCPL-GI---Y-F-LK---FC------E-H-T-T----LGCIPE-GFPH-DG--D----DW-P-V---P-K-P--DS-----Q-W---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --L----------L-S-N-----H-SP---D-------R-----P---NN-RR--RS-----------T----S------------------MD-V--PR-R-FQ--F-------Q-----R---Q---------R------ SAPs(SNPs) (2)
             SAPs(SNPs) (3) --W----------S-T-R-----L------S-----------------R--SY--------------------Y-------------------N----QW----W--G-----------------V---------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------------------R---------------------------------------------------------------------------Y------------------------------------------ SAPs(SNPs) (4)
             SAPs(SNPs) (5) -----------------------S---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: C:63-114 UniProt: 1-114 [INCOMPLETE]----------------------------------------Exon 1.6d  PDB: C:155-204 UniProt: 155-213         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.4  PDB: C:114-155 (gaps)           ------------------------------------------------- Transcript 1 (2)
                 3ztc C  63 LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLN-DGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE 204
                                    72        82        92       102       112       122       132        |-|      152       162       172       182       192       202  
                                                                                                        141 |                                                             
                                                                                                          143                                                             

Chain D from PDB  Type:PROTEIN  Length:99
 aligned with ELOB_HUMAN | Q15370 from UniProtKB/Swiss-Prot  Length:118

    Alignment length:101
                                    10        20        30        40        50        60        70        80        90       100 
           ELOB_HUMAN     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPD 101
               SCOP domains d3ztcd_ D: Elongin B                                                                                  SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeeee...hhhhhhhhhhhhhh.hhh.eeee...........................eeeeeee.--................... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBIQUITIN_2  PDB: D:1-66 UniProt: 1-66                            ----------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 3ztc D   1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFR--DTFEALCIEPFSSPPELPD 101
                                    10        20        30        40        50        60        70        80  |     90       100 
                                                                                                          80 83                  

Chain E from PDB  Type:PROTEIN  Length:87
 aligned with ELOC_HUMAN | Q15369 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:96
                                    26        36        46        56        66        76        86        96       106      
           ELOC_HUMAN    17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
               SCOP domains d3ztce_ E: Elongin C                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeeehhhhhhhhhhhhhh..---------.eee....hhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) ---------------------------------Exon 2.10d  PDB: E:58-112 UniProt: 50-112 [INCOMPLETE]          Transcript 2 (1)
           Transcript 2 (2) Exon 2.7  PDB: E:17-48            -------------------------------------------------------------- Transcript 2 (2)
                 3ztc E  17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSG---------NEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
                                    26        36        46 |       - |      66        76        86        96       106      
                                                          48        58                                                      

Chain F from PDB  Type:PROTEIN  Length:142
 aligned with VHL_HUMAN | P40337 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:142
                                    72        82        92       102       112       122       132       142       152       162       172       182       192       202  
            VHL_HUMAN    63 LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE 204
               SCOP domains d3ztcf_ F: automated matches                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeee.....eeeeee.....eee........eeeeeee....eeeee.......ee................eeeeee....hhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhh..hhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) PPA--W-K---G-I-HPISP-L-A-RH-L-C--P-H--G--APDG--YCH-CQVCPL-GI---Y-F-LK---FC------E-H-T-T----LGCIPE-GFPH-DG--D----DW-P-V---P-K-P--DS-----Q-W---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --L----------L-S-N-----H-SP---D-------R-----P---NN-RR--RS-----------T----S------------------MD-V--PR-R-FQ--F-------Q-----R---Q---------R------ SAPs(SNPs) (2)
             SAPs(SNPs) (3) --W----------S-T-R-----L------S-----------------R--SY--------------------Y-------------------N----QW----W--G-----------------V---------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------------------R---------------------------------------------------------------------------Y------------------------------------------ SAPs(SNPs) (4)
             SAPs(SNPs) (5) -----------------------S---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: F:63-114 UniProt: 1-114 [INCOMPLETE]----------------------------------------Exon 1.6d  PDB: F:155-204 UniProt: 155-213         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------Exon 1.4  PDB: F:114-155 UniProt: 114-155 ------------------------------------------------- Transcript 1 (2)
                 3ztc F  63 LRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE 204
                                    72        82        92       102       112       122       132       142       152       162       172       182       192       202  

Chain G from PDB  Type:PROTEIN  Length:105
 aligned with ELOB_HUMAN | Q15370 from UniProtKB/Swiss-Prot  Length:118

    Alignment length:105
                                    10        20        30        40        50        60        70        80        90       100     
           ELOB_HUMAN     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKP 105
               SCOP domains d3ztcg_ G: Elongin B                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeeee...hhhhhhhhhhhhhh.hhh.eeeee..ee.....hhhhhh.hhhhh.....eeeeeee....................hhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBIQUITIN_2  PDB: G:1-66 UniProt: 1-66                            --------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                 3ztc G   1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKP 105
                                    10        20        30        40        50        60        70        80        90       100     

Chain H from PDB  Type:PROTEIN  Length:86
 aligned with ELOC_HUMAN | Q15369 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:96
                                    26        36        46        56        66        76        86        96       106      
           ELOC_HUMAN    17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
               SCOP domains d3ztch_ H: Elongin C                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeeehhhhh.hhhhhhhh..---------.eee....hhhhhhhhhhhhhhhhhhh..-........hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) ---------------------------------Exon 2.10d  PDB: H:58-112 (gaps) UniProt: 50-112 [INCOMPLETE]   Transcript 2 (1)
           Transcript 2 (2) Exon 2.7  PDB: H:17-48            -------------------------------------------------------------- Transcript 2 (2)
                 3ztc H  17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSG---------NEVNFREIPSHVLSKVCMYFTYKVRYTNS-TEIPEFPIAPEIALELLMAANFLDC 112
                                    26        36        46 |       - |      66        76        86 |      96       106      
                                                          48        58                          86 |                        
                                                                                                  88                        

Chain I from PDB  Type:PROTEIN  Length:145
 aligned with VHL_HUMAN | P40337 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:145
                                    71        81        91       101       111       121       131       141       151       161       171       181       191       201     
            VHL_HUMAN    62 VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERI 206
               SCOP domains d3ztci_ I: automated matches                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeeee.....eeeeee.....eee........eeeeeee...eeeeee.......ee................eeeeee....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -PPA--W-K---G-I-HPISP-L-A-RH-L-C--P-H--G--APDG--YCH-CQVCPL-GI---Y-F-LK---FC------E-H-T-T----LGCIPE-GFPH-DG--D----DW-P-V---P-K-P--DS-----Q-W------ SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---L----------L-S-N-----H-SP---D-------R-----P---NN-RR--RS-----------T----S------------------MD-V--PR-R-FQ--F-------Q-----R---Q---------R-------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---W----------S-T-R-----L------S-----------------R--SY--------------------Y-------------------N----QW----W--G-----------------V------------------ SAPs(SNPs) (3)
             SAPs(SNPs) (4) ------------------------R---------------------------------------------------------------------------Y-------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) ------------------------S------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) (5)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: I:62-114 UniProt: 1-114 [INCOMPLETE] ----------------------------------------Exon 1.6d  PDB: I:155-206 UniProt: 155-213           Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.4  PDB: I:114-155 UniProt: 114-155 --------------------------------------------------- Transcript 1 (2)
                 3ztc I  62 VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERI 206
                                    71        81        91       101       111       121       131       141       151       161       171       181       191       201     

Chain J from PDB  Type:PROTEIN  Length:104
 aligned with ELOB_HUMAN | Q15370 from UniProtKB/Swiss-Prot  Length:118

    Alignment length:104
                                    10        20        30        40        50        60        70        80        90       100    
           ELOB_HUMAN     1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK 104
               SCOP domains d3ztcj_ J: Elongin B                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee..eeeeeeee...hhhhhhhhhhhhhh.hhhhheeee..ee.....hhhhhh...........eeeeee.......................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE UBIQUITIN_2  PDB: J:1-66 UniProt: 1-66                            -------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 3ztc J   1 MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK 104
                                    10        20        30        40        50        60        70        80        90       100    

Chain K from PDB  Type:PROTEIN  Length:87
 aligned with ELOC_HUMAN | Q15369 from UniProtKB/Swiss-Prot  Length:112

    Alignment length:96
                                    26        36        46        56        66        76        86        96       106      
           ELOC_HUMAN    17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
               SCOP domains d3ztck_ K: Elongin C                                                                             SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.....eeeeehhhhh.hhhhhhh...---------.eee....hhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------ PROSITE
           Transcript 2 (1) ---------------------------------Exon 2.10d  PDB: K:58-112 UniProt: 50-112 [INCOMPLETE]          Transcript 2 (1)
           Transcript 2 (2) Exon 2.7  PDB: K:17-48            -------------------------------------------------------------- Transcript 2 (2)
                 3ztc K  17 MYVKLISSDGHEFIVKREHALTSGTIKAMLSG---------NEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 112
                                    26        36        46 |       - |      66        76        86        96       106      
                                                          48        58                                                      

Chain L from PDB  Type:PROTEIN  Length:143
 aligned with VHL_HUMAN | P40337 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:143
                                    71        81        91       101       111       121       131       141       151       161       171       181       191       201   
            VHL_HUMAN    62 VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE 204
               SCOP domains d3ztcl_ L: automated matches                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........eeeeeeee.....eeeeee.....eee........eeeeeee...eeeeee.......ee................eeeeee....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhh. Sec.struct. author
             SAPs(SNPs) (1) -PPA--W-K---G-I-HPISP-L-A-RH-L-C--P-H--G--APDG--YCH-CQVCPL-GI---Y-F-LK---FC------E-H-T-T----LGCIPE-GFPH-DG--D----DW-P-V---P-K-P--DS-----Q-W---- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---L----------L-S-N-----H-SP---D-------R-----P---NN-RR--RS-----------T----S------------------MD-V--PR-R-FQ--F-------Q-----R---Q---------R------ SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---W----------S-T-R-----L------S-----------------R--SY--------------------Y-------------------N----QW----W--G-----------------V---------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ------------------------R---------------------------------------------------------------------------Y------------------------------------------ SAPs(SNPs) (4)
             SAPs(SNPs) (5) ------------------------S---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: L:62-114 UniProt: 1-114 [INCOMPLETE] ----------------------------------------Exon 1.6d  PDB: L:155-204 UniProt: 155-213         Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------Exon 1.4  PDB: L:114-155 UniProt: 114-155 ------------------------------------------------- Transcript 1 (2)
                 3ztc L  62 VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQE 204
                                    71        81        91       101       111       121       131       141       151       161       171       181       191       201   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 12)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3ZTC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3ZTC)

(-) Gene Ontology  (39, 58)

Asymmetric Unit(hide GO term definitions)
Chain A,D,G,J   (ELOB_HUMAN | Q15370)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0031625    ubiquitin protein ligase binding    Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
    GO:0006461    protein complex assembly    The aggregation, arrangement and bonding together of a set of components to form a protein complex.
    GO:0016567    protein ubiquitination    The process in which one or more ubiquitin groups are added to a protein.
    GO:0061418    regulation of transcription from RNA polymerase II promoter in response to hypoxia    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006368    transcription elongation from RNA polymerase II promoter    The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
    GO:0006366    transcription from RNA polymerase II promoter    The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
cellular component
    GO:0031462    Cul2-RING ubiquitin ligase complex    A ubiquitin ligase complex in which a cullin from the Cul2 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by an elongin-BC adaptor and a SOCS/BC box protein.
    GO:0031466    Cul5-RING ubiquitin ligase complex    A ubiquitin ligase complex in which a cullin from the Cul5 subfamily and a RING domain protein form the catalytic core; substrate specificity is conferred by an elongin-BC adaptor and a SOCS/BC box protein.
    GO:0030891    VCB complex    A protein complex that possesses ubiquitin ligase activity; the complex is usually pentameric; for example, in mammals the subunits are pVHL, elongin B, elongin C, cullin-2 (Cul2), and Rbx1.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0070449    elongin complex    A transcription elongation factor complex that suppresses RNA polymerase II pausing, and may act by promoting proper alignment of the 3'-end of nascent transcripts with the polymerase catalytic site. Consists of a transcriptionally active Elongin A subunit (abut 100 kDa)and two smaller Elongin B (about 18 kDa) and Elongin C (about 15 kDa)subunits.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,E,H,K   (ELOC_HUMAN | Q15369)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004842    ubiquitin-protein transferase activity    Catalysis of the transfer of ubiquitin from one protein to another via the reaction X-Ub + Y --> Y-Ub + X, where both X-Ub and Y-Ub are covalent linkages.
biological process
    GO:0032968    positive regulation of transcription elongation from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription elongation, the extension of an RNA molecule after transcription initiation and promoter clearance by the addition of ribonucleotides, catalyzed by RNA polymerase II.
    GO:0042787    protein ubiquitination involved in ubiquitin-dependent protein catabolic process    The process in which a ubiquitin group, or multiple groups, are covalently attached to the target protein, thereby initiating the degradation of that protein.
    GO:0006357    regulation of transcription from RNA polymerase II promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0061418    regulation of transcription from RNA polymerase II promoter in response to hypoxia    Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter as a result of a hypoxia stimulus.
    GO:0006355&n